You Searched For: Molecular+Bioproducts+Inc.

Supplier: Rockland Immunochemical

Description: This mixture contains seven purified proteins that range in size from 14 to 120kDa

Supplier: PeproTech, Inc.

Description: Plasminogen Activator Inhibitor-1 (PAI-1, Serpin E1) is a member of the serpin family of serine protease inhibitors, and is the primary inhibitor of urokinase and tissue plasminogen activator (tPA). PAI-1 is expressed predominantly in adipose, liver and vascular tissues, but is also produced by certain tumor cells. Elevated levels of PAI-1 are associated with obesity, diabetes and cardiovascular disease, and increased production of PAI-1 is induced by various obesity-related factors, such as TNFα, glucose, insulin, and very-low-density lipoprotein. The obesity-related elevation of PAI-1 levels, along with the consequential deficiency in plasminogen activators, can lead directly to increased risk of thrombosis and other coronary diseases. Accordingly, PAI-1 has been implicated as an important molecular link between obesity and coronary disease. PAI-1 can also specifically bind vitronectin (VTN) to form a stable active complex with an increased circulatory half-life relative to free PAI-1. Recombinant Human PAI-1 is a 42.7 kDa protein containing 379 amino acid residues.

Catalog Number: (470007-002)

Supplier: Cochranes of Oxford

Description: Excellent for Lessons on Structure and Bonding.

Sale

Catalog Number: (PAD1501)

Supplier: Promega Corporation

Description: Generates molecular weight size markers used in gel analysis of nucleic acids; nucleotide sequence has been determined.

Certificates Sale

Catalog Number: (470225-688)

Supplier: Ward's Science

Description: CAS Number: 497-19-8
Formula: Na2CO3
Density: 2.533 g/mL
Freezing Point: 864°C
Solubility: Water and Glycerin
Synonyms: Soda Ash
Shelf Life: 36 Months

SDS Sale

Catalog Number: (103007-508)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 7 fragment of the histone H4. Alterations in chromatin structure, such as nucleosome sliding, removal of nucleosomes, and disruption of DNA–histone or histone–histone contacts through post-translational modification of the histones, have been linked to transcriptional regulation, DNA damage repair, and replication, among other cellular processes. Modification of histones occurs primarily in the N-terminal residues or tail region. These modifications include phosphorylation, ubiquitinylation, methylation, sumolyation, and acetylation. Lys5 may serve as the acetylation site for this peptide.
Sequence:SGRGKGG
MW:617.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-278)

Supplier: Anaspec Inc

Description: This peptide is a 1 to 20 amino acid fragment of the interphotoreceptor retinoid binding protein (IRBP). IRBP is a 140-kDa glycolipoprotein residing in the interphotoreceptor matrix between the neural retina and the retinal pigment epithelium. Human IRBP peptide 1-20 contains a major epitope for the H-2b haplotype. Immunization with IRBP (1 – 20) induces T-cell–mediated experimental autoimmune uveoretinitis (EAU) disease. The pathology of disease induced by the peptide, or by adoptive transfer of cells specific to the peptide, is similar to that induced by the whole IRBP protein.
Sequence:GPTHLFQPSLVLDMAKVLLD
MW:2194.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: BeanTown Chemical

Description: CAS: 70955-01-0; MDL No: MFCD00131613 Beads; Linear Formula: Na12[(AlO2)12(SiO2)12]·xH2O Hygroscopic

SDS

Catalog Number: (103006-562)

Supplier: Anaspec Inc

Description: This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-544)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-21), acetylated at lysine 12. The N-terminus contains a C-terminus GG linker followed by a biotinylated lysine. The acetylation of histone H4 plays a crucial role in structural changes that amplifies the binding of transcription factors to their recognition sites within the nucleosomes. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Ward's Science

Description: CAS Number: 1310-73-2
Formula: NaOH
Density: 2.13 g/mL
Boiling and Freezing Point: 1390°C, 318°C
Solubility: Water and Alcohol
Synonyms: Caustic Soda
Shelf Life: 36 Months

SDS

Catalog Number: (102999-752)

Supplier: Anaspec Inc

Description: ß-Secretase (BACE1) is a key enzyme involved in the production of Aß peptides found in extracellular amyloid plaques of Alzheimer’s disease (AD). The enzyme has been implicated as an excellent target for anti-amyloid therapy of AD. This statine-based substrate analog, beta-secretase inhibitor P10–P4’ statV, is used in the inhibition of beta-secretase activity from homogenized wild-type mouse cortices and from BACE-purified from human brain.
Sequence:KTEEISEVN-Sta-VAEF (Sta = statine)
MW:1651.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-678)

Supplier: Anaspec Inc

Description: This is an amidated peptide derived from residues 361-393 of human p53 tumor suppressor protein with acetylation at Lys382. This peptide is biotin-labeled at its N-terminus with a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-GSRAHSSHLKSKKGQSTSRHK-K(Ac)-LMFKTEGPDSD-NH2
MW:4034.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: Osteocalcin (OC) is a 49 amino acid peptide found exclusively in bone tissue and is highly conserved among species. It is a vitamin K- and D-dependent protein produced by osteoblasts, osteocytes and odontoblasts. It is deposited in extracellular bone matrix and is found in the serum. Serum osteocalcin, hydrolysed in the kidney and liver, is considered a specific marker of osteoblast activity and bone formation rate. It may be involved in regulation of osteoblast function, regulation of bone turnover and/or mineralization.
Sequence: YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
MW: 5929.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: VWR

Description: VividPro™ is a generic fluorescent stain for protein gel electrophoresis that can be used to visualize proteins.

SDS Certificates

Supplier: New England Biolabs (NEB)

Description: The HindIII digest of lambda DNA (cI857ind1 Sam 7) yields 8 fragments suitable for use as molecular weight standards for agarose gel electrophoresis