You Searched For: Molecular+Bioproducts+Inc.

Catalog Number: (76303-796)

Supplier: PeproTech, Inc.

Description: Human IL-31 is a T cell-derived cytokine that shares several structural and functional characteristics with IL-6, Oncostatin M, LIF, and Cardiotrophin-1. It signals through a receptor complex comprised of GPL (also known as gp130-like receptor or IL-31RA) and Oncostatin-M receptor (OSMR). GPL/OSMR signaling is a strong activator of STAT3 and STAT5, and can also activate STAT1, JAK1, and JAK2 signaling pathways. IL-31-regulated immune responses have been implicated in skin physiology and inflammatory skin diseases. Recombinant Human IL-31 is a 15.8 kDa protein containing 141 amino acid residues.

Sale

Supplier: Anaspec Inc

Description: Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # NP_034944) corresponding to the extracellular domain of mouse MOG along with a 6x His tag was expressed in E. coli. The recombinant mouse MOG (M-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant mouse MOG is 14.2 kDa

Catalog Number: (103007-656)

Supplier: Anaspec Inc

Description: This is a H3 peptide acetylated at the lysine residue at the 14th position. This peptide has been shown to act as part of the active promoter state and the extent of its acetylation could be driven by cis regulatory elements such as CpG contents at promoters. It's expression has been shown to be decreased as malignancy of ovarian epithelial tumors increased, suggesting that this peptide could act as a prognostic marker although it does not show significant relation with the occurence or development of ovarian tumors.
Sequence:KSTGG-K(Ac)-APRKQ
MW:1199.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: PeproTech, Inc.

Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRalpha (alpha1-alpha4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson's disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional rat GDNF ligand is a disulfide-linked homodimer consisting of two 15 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine-knot configuration. The calculated molecular weight of Recombinant Rat GDNF is 30.0 kDa.

Supplier: PeproTech, Inc.

Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional murine GDNF ligand is a disulfide-linked homodimer consisting of two 15.1 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Murine GDNF is 30.2 kDa.

Supplier: Anaspec Inc

Description: The sequence (Accession # AAC04279.1) corresponding to the full length human Tau-441 (2N4R isoform) protein along with GST tag at N-terminal was expressed in E. coli. The recombinant GST-Tau-441 protein was purified from bacterial lysate using proprietary method.
Microtubule associated protein (Tau) is found predominantly in the central neural system and its major function is to promote assembly and to stabilize neuronal microtubules. Six isoforms of Tau were identified in humans that are differentiated by the exclusion or inclusion of exons 2, 3, and 10. Tau-441 is the longest of Tau isoforms, consisting of 441 amino acids with molecular mass of 45.8 kDa. Under physiological conditions Tau can undergo abnormal phosphorylation, truncation, or other modifications that result in the protein detachment from microtubules. These modified Tau molecules can self-associate and form different types of aggregates including neurofibrillary tangles (NFTs) found in brains of patients with neurodegenerative diseases such as Alzheimer’s disease.

Catalog Number: (103010-584)

Supplier: Anaspec Inc

Description: This human recombinant SIRT2 is in its active form, and can be used for enzyme activity assays. The recombinant human Sirtuin 2 (GenBank Accession #: NM_030593) with 13-319 amino acids and His tag at its C-terminal was expressed in E. coli. The molecular mass of the enzyme is approximately 35.5 kDa on SDS-PAGE.
Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates.
Sirtuin 1 (SIRT1), the human homolog of yeast Sir2 (Silent Information Regulator 2), is the most studied of the seven members of sirtuin family. SIRT1 have been implicated in several important cellular processes, including genomic stability and DNA repair, p53-mediated apoptosis, adipogenesis, and aging.
Substrates for SIRT2 are not limited to histones but also include various transcription factors and co-regulators that modulate metabolic, cell cycle and cell death related pathways. Human SIRT2 is a cytoplasmic protein that increases in abundance during mitosis and regulates major events of cytokinesis.

Sale

Supplier: Wards

Description: Ideally Suited for Advance Level Courses.

Supplier: ACROBIOSYSTEMS

Description: SARS-CoV-2 (COVID-19) S protein RBD, Mouse IgG2a Fc Tag, ACROBiosystems

Supplier: Cochranes of Oxford

Description: Order extra atoms, bonds, and accessories to supplement your Minit® Sets.

Catalog Number: (EM1.05743.1000)

Supplier: MilliporeSigma

SDS Certificates Sale

Catalog Number: (103007-216)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103007-254)

Supplier: Anaspec Inc

Description: This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.
Sequence:DABCYL-LPETG-EDANS
MW:1015.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-812)

Supplier: Anaspec Inc

Description: This insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7. A number of autoimmune diseases has been linked to class II proteins encoded by the MHC. Type 1 diabetes, or insulin-dependent diabetes mellitus, is a T cell-mediated disease that results in autoimmune destruction of pancreatic beta-cells leading to hyperglycemia. This insulin B peptide may be a self-antigen candidate that could initiate the disease. Immunization with this peptide in mice led to autoantibodies and insulitis.
Sequence: SHLVEALYLVCGERG
MW: 1645.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103008-636)

Supplier: Anaspec Inc

Description: This peptide is histone H4 amino acid residues 1 to 21. It is monomethylated at Arg3, with an acetylated N-terminus and C-terminal GG linker, followed by a biotinylated Lys. Methylation of histone H4 at Arg3 is an important step in transcriptional activation and allows for subsequent acetylation of H4 tails by p300. Provided at >90% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.'
Sequence:Ac-SG-R(Me1)-GKGGKGLGKGGAKRHRKV-GGK(Biotin)
MW:2616.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.