Print…

You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

Refine Results Sort by
SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-BJ334316-1KG

Molecular sieve A5 (0.5 nm, 5 Å), pellets, Fluka™

Catalog Number: (BJ334316-1KG)
Supplier: Honeywell Research Chemicals
Description: Molecular sieves, 5 A, Analytical, pellets, 1.6 mm diameter, CAS Number: 69912-79-4, Linear Formula: Ca/nNa12-2n[(AlO2)12(SiO2)12<, Pore Size ( armstrong ngstrom) 5, Particle Size 1.6 mm, Adsorbent, Size: 1KG
Product Image-53515-858

Finntip™ Pipette Tips, Thermo Scientific

Supplier: Thermo Fisher Scientific
Description: These high-quality pipette tips are specifically designed to fit Finnpipette® pipettors, but are also compatible with most pipettor brands.

Image Unavailable-103003-398

Human Galanin

Catalog Number: (103003-398)
Supplier: Anaspec Inc
Description: Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.
Sequence:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
MW:3157.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-BJ208647-1KG

Molecular sieve 13X (1.0 nm, 10 Å), beads 8-12 mesh, Fluka™

Catalog Number: (BJ208647-1KG)
Supplier: Honeywell Research Chemicals
Description: Molecular sieves, 13X, 8-12 mesh, Adsorbent, Grade: Analytical, Cas number: 63231-69-6, Molecular Formula: Na86[AlO2)86(SiO2)106].xH2O, Molar mass: 225.65 g/mol, Container: Poly bottle, Appearance: Off White to Light Brown Beads, Size: 1KG

SDS


Image Unavailable-103790-358

Cynomolgus Monkey, Rhesus macaque Recombinant FcRn (FCGRT & B2M) (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus / Rhesus macaque FcRn / FCGRT&B2M Heterodimer Protein, His Tag (BLI verified), ACROBiosystems

Image Unavailable-103871-096

Cynomolgus Monkey Recombinant TRAIL R2 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus TRAIL R2 / DR5 / TNFRSF10B Protein, His Tag (MALS verified), ACROBiosystems

Image Unavailable-AA88120-A7

Molecular sieve A4 (0.4 nm, 4 Å) ≥99%, pellets, Diameter 3-4mm (0.12-0.16in)

Supplier: Thermo Scientific Chemicals
Description: 1KG

SDS Certificates

Image Unavailable-103004-646

Mouse Recombinant MOG (1-125) (from E. coli)

Supplier: Anaspec Inc
Description: Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # NP_034944) corresponding to the extracellular domain of mouse MOG along with a 6x His tag was expressed in E. coli. The recombinant mouse MOG (M-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant mouse MOG is 14.2 kDa

Image Unavailable-103007-588

Leech Hirudin (54-65)

Catalog Number: (103007-588)
Supplier: Anaspec Inc
Description: This is amino acids 54 to 65 fragment of sulfated hirudin, a 65-residue peptide. Hirudin is found in the saliva of the leech Hirudo medicinalis. This sulfated peptide binds tightly to anion-binding exosite I of thrombin, but does not inhibit hydrolysis of synthetic peptide substrates.
Sequence:Ac-GDFEEIPEE-Y(SO3H)-LQ
MW:1590.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-564

L. monocytogenes LLO (91-99)

Catalog Number: (103008-564)
Supplier: Anaspec Inc
Description: This peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), consisting of amino acids 91 to 99. LLO is necessary for Listeria monocytogenes to escape the vacuoles of host cells and enter the cytoplasm during infection. This fragment has been shown to be a potential vaccine candidate against L. monocytogenes by eliciting a CTL response in vivo.
Sequence:GYKDGNEYI
MW:1058.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-718

Alpha9-Gliadin (57-68)

Catalog Number: (103008-718)
Supplier: Anaspec Inc
Description: Gliadin is a gluten component. This peptide is derived from amino acid residues 57-68 of a9-gliadin and represents an immunodominant epitope that has been shown to elicit HLA-DQ2-restricted T-cell responses in celiac patients. This epitope is resistant to pancreatic proteolysis.
Sequence: QLQPFPQPQLPY
MW: 1455.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Product Image-470129-048

BRIGHT™ Teacher Molecule

Catalog Number: (470129-048)
Supplier: BRIGHT OF SWEDEN
Description: Intuitive and Hands-On Teaching Tool.
Image Unavailable-103871-466

SARS-CoV-2 Recombinant S protein RBD (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: SARS-CoV-2 (COVID-19) S protein RBD, Mouse IgG2a Fc Tag, ACROBiosystems

Product Image-470320-052

Minit® Atoms, Bonds and Accessories

Supplier: Cochranes of Oxford
Description: Order extra atoms, bonds, and accessories to supplement your Minit® Sets.

Product Image-BJ34241-250G

Molecular sieve 3A (0.3 nm, 3 Å), Hydranal™ drying agent, for air and gases for Karl Fischer titration, Diameter ~2 mm, Fluka™

Catalog Number: (BJ34241-250G)
Supplier: Honeywell Research Chemicals
Description: Hydranal* Molecular sieve 0.3 nm, Drying agent for air and gases for KF titration, Cas: 7761-88-8, Molar mass:  169.87 g/mol, Container Type: Glass bottle, Pore size: 0.3 nm, Size: 250G

SDS Certificates


Product Image-470231-432

Molecular Model Set, 65 Atoms

Catalog Number: (470231-432)
Supplier: Wards
Description: Versatile Model Set
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,385 - 2,400 of 249,603
no targeter for Bottom