You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: Anaspec Inc
Description: Scrambled control peptide of beta-amyloid are often used in studies to compare the effects of wild type Beta-Amyloid (1-40).

Supplier: Anaspec Inc
Description: Aß (25-35) is the main factor responsible for Aß neurotoxic effects.

Supplier: Strem Chemicals Inc
Description: Schrock-Hoveyda Catalyst

Catalog Number: (103011-162)
Supplier: Anaspec Inc
Description: Acrylodan is a thiol-reactive dye whose fluorescence is very sensitive to conformational changes, and is well-adapted to protein structural analyses.


Catalog Number: (103003-308)
Supplier: Anaspec Inc
Description: Orange fluorescent biotin used for studying avidin binding


Catalog Number: (103011-034)
Supplier: Anaspec Inc
Description: This product is a very useful building block and a good transglutaminase substrate.


Catalog Number: (103003-304)
Supplier: Anaspec Inc
Description: Excellent reagent for detecting polyhistidine-containing biomolecules


Supplier: QUALITY BIOLOGICAL, INC.
Description: TBE (TRIS Borate EDTA) is often used in procedures involving nucleic acids, the most common being electrophoresis in molecular biology. Tris-acid solutions are effective buffers for slightly basic conditions, which keep DNA deprotonated and soluble in water.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (103006-990)
Supplier: Anaspec Inc
Description: This peptide is beta-Amyloid (1-15), human sequence.Sequence: DAEFRHDSGYEVHHQ
Molecular Weight: 1826.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-242)
Supplier: Anaspec Inc
Description: The is a reverse sequence of LL-37 used in control experiments.
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Catalog Number: (103010-216)
Supplier: Anaspec Inc
Description: A lipophilic membrane stain that diffuses laterally to stain the entire cell; Its fluorescence is significantly enhanced upon membrane incorporation.


Catalog Number: (103007-122)
Supplier: Anaspec Inc
Description: This is the hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42.
Sequence: EDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 1999.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103011-376)
Supplier: Anaspec Inc
Description: Environment-sensitive dye for studying membranes and structures of proteins.


Supplier: AAT BIOQUEST INC
Description: Calcium measurement is critical for numerous biological investigations.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier: Thermo Fisher Scientific Chemicals Inc.
Description: High purity dH<sub>2</sub>O treated overnight with 0.1% Diethylpyrocarbonate. Product is 0.2 μm filtered and dispensed into vials and/or durable, square Nalgene bottles, then autoclaved.
Supplier: VWR International
Description: Hands-On Manipulation with Colorful Models.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
225 - 240 of 249,603
no targeter for Bottom