You Searched For: viral+rna


613,118  results were found

SearchResultCount:"613118"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103015-534)
Supplier: ACROBIOSYSTEMS
Description: CD40/TNFRSF5 Protein, Fc Tag, Host: HEK293, Species Reactivity: Mouse, Purity: >92% by SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at C-terminus, MW of 44.9 kDa, Synonym: CD40,Bp50,CDW40,MGC9013,TNFRSF5,p50, Storage: 4 deg C, Size: 100ug


Catalog Number: (103012-416)
Supplier: ACROBIOSYSTEMS
Description: Human CD2/SRBC Protein, Host: HEK293 cells, species reactivity: human, Purity: >98% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 22.7 kDa, Synonym: CD2,SRBC,LFA-2,T11, Storage: 4 deg C, Size: 1mg


Catalog Number: (103012-418)
Supplier: ACROBIOSYSTEMS
Description: Human CD2/SRBC Protein, Host: HEK293 cells, species reactivity: human, Purity: >98% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 22.7 kDa, Synonym: CD2,SRBC,LFA-2,T11, Storage: 4 deg C, Size: 50ug


Catalog Number: (103012-964)
Supplier: ACROBIOSYSTEMS
Description: FABP6 Protein, Host: E.coli, Species reactivity: Human, Purity: >92% SDS-PAGE, Molecular Characterization: fused with 6xHis tag at N-terminus, MW 15.3 kDa, Endotoxin: <1.0 EU per ug, Synonym: FABP6, ILBP, ILLBP, Gastrotropin, GT, I-15P, Storage: at 4 deg C, Size: 1mg


Catalog Number: (103012-266)
Supplier: ACROBIOSYSTEMS
Description: Human BMP-2 Protein, Tag Free, Host: HEK293 cells, Species Reactivity: Human, purity: >92% SDS-PAGE, Molecular Characterization: calculated MW of 13 kDa, Endotoxin: Less than 1.0 EU per ug of the Human BMP-2, Synonym: BMP2,BMP2A, Storage: 4 Degree C, size: 20ug


Catalog Number: (103012-264)
Supplier: ACROBIOSYSTEMS
Description: Human BMP-2 Protein, Tag Free, Host: HEK293 cells, Species Reactivity: Human, purity: >92% SDS-PAGE, Molecular Characterization: calculated MW of 13 kDa, Endotoxin: Less than 1.0 EU per ug of the Human BMP-2, Synonym: BMP2,BMP2A, Storage: 4 Degree C, size: 200ug


Catalog Number: (103012-382)
Supplier: ACROBIOSYSTEMS
Description: Human Semaphorin 4D/SEMA4D/CD100 Protein, Host: HEK293 cells, species reactivity: human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 105.4 kDa, Synonym: SEMA4D, CD100, Size: 1mg


Catalog Number: (102998-444)
Supplier: Anaspec Inc
Description: [Des - Pro2] - Bradykinin, Angiotensin I Converting Enzyme (ACE I) Inhibitor, for Angiotensin I Converting Enzyme, Purity % Peak Area By HPLC >/=95%, Molecular Weight 1060.2, Sequence: RPPGFSPFR, Size: 5mg


Catalog Number: (103014-090)
Supplier: ACROBIOSYSTEMS
Description: CD36/SR-B3 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 47.5KDa, Synonyms: CD36,SCARB3,BDPLT10,CHDS7,FAT,GP3B,GP4, Storage: 4 deg C, Size: 100ug


Catalog Number: (103007-244)
Supplier: Anaspec Inc
Description: TAT - NSF700scr, Sequence: YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL, (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide, Molecular Weight: 4109.9, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103790-728)
Supplier: ACROBIOSYSTEMS
Description: PE-Labeled PD-1 PDCD1 Protein, Fc Tag, Recombinant, Source: HEK293, Species: human, Molecular weight: 44.7 kDa, Synonyms: PDCD1, PD1, CD279, SLEB2, Size: 50TEST


Catalog Number: (103006-920)
Supplier: Anaspec Inc
Description: HSV-gB2 (498-505) immunodominant epitope gB-8p from herpes simplex virus (HSV) glycoprotein B (gB), Purity: HPLC>/=95%, Sequence (1-Letter Code): SSIEFARL, (3-Letter Code) H-Asn-Glu-Lys-Tyr-Ala-Gln-Ala-Tyr-Pro-Asn-Val-Ser-OH, Molecular weight: 1383.5, Size: 1 mg


Catalog Number: (103007-238)
Supplier: Anaspec Inc
Description: Pro - apoptotic Peptide, klaklakklaklak, 5 - FAM - labeled, Sequence: 5 - FAM - klaklakklaklak - NH2, Purity: HPLC greater than or equal to 95%, composed of D-amino acids, 5-FAM labeled, Molecular Weight: 1881.3, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103006-236)
Supplier: Anaspec Inc
Description: C - peptide, dog, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): EVEDLQVRDVELAGAPGEGGLQPLALEGALQ, Molecular Weight: 3174.5, Physical State: Powder, Insulin secretory rate can be estimated, Storage: -20 degree C, Size: 0.5mg


Catalog Number: (10778-730)
Supplier: PeproTech, Inc.
Description: Recombinant Human BD-5, 57.8 kDa protein containing 51 amino acid residues, Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds, Animal-Free Cytokines, Source: E.coli, >98%, Synonyms: BD5, DEFB5, DEFB105a, Beta-Defensin 5, 250UG


Catalog Number: (10778-726)
Supplier: PeproTech, Inc.
Description: Recombinant Human BD-5, 57.8 kDa protein containing 51 amino acid residues, Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds, Animal-Free Cytokines, Source: E.coli, >98%, Synonyms: BD5, DEFB5, DEFB105a, Beta-Defensin 5, 20UG


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,409 - 1,424 of 613,118
no targeter for Bottom