You Searched For: Molecular+Bioproducts+Inc.

Catalog Number: (103008-722)

Supplier: Anaspec Inc

Description: This peptide is derived from the V1 domain of protein kinase C (PKC)d. It inhibits phorbol 12-myristate 13-acetate (PMA)-induced PKCd translocation and activation. Inhibition of PKCd reduces ischemia damage in cardiac and cerebral cells, induces proliferation of fibroblasts, and inhibits graft coronary artery disease in mice.
Sequence:SFNSYELGSL
MW:1116.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (470120-980)

Supplier: Mega Molecules

Description: The Advanced General and Organic Chemistry Molecular Model Set has all of the parts necessary to be successful in a college/university level General or Organic Chemistry course.

Sale

Catalog Number: (103007-414)

Supplier: Anaspec Inc

Description: Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.
Sequence:GKPRPYSPRPTSHPRPIRV
MW:2198.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-856)

Supplier: Anaspec Inc

Description: TAMRA-X contains a seven-atom aminohexanoyl spacer (known as ‘X’) between TAMRA fluorophore and the succinimidyl ester. The ‘X’ spacer separates the fluorophore from the biomolecule to which it is conjugated, potentially reducing the quenching that typically occurs upon conjugation. We recommend this TAMRA-X derivative as the preferred dye for preparing TAMRA-labeled proteins when the fluorescence quenching of the labeling dye by protein is a serious problem.

Sale

Catalog Number: (TS264755000)

Supplier: THERMO FISHER SCIENTIFIC CHEMICALS

Description: Molecular sieve A4 (0.4 nm, 4 Å) 10 --> 18 mesh

New Product Sale

Supplier: PeproTech, Inc.

Description: Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2), or CD28H, is a type I costimulatory transmembrane receptor of the CD28 receptor family that functions as both an adhesion molecule and regulator of T cell function. TMIGD2 is constitutively expressed on naive T cells and NK cells, although expression is rapidly lost upon stimulation. Interaction with its ligand, B7-H7/HHLA2, co-stimulates T cell proliferation and differentiation, as well as increases cytokine production through the Akt pathway. TMIGD2 is also widely expressed on cells of epithelial and endothelial origin where it regulates cell morphology and cell-cell interaction, reduces cell migration and promotes angiogenesis. The cytoplasmic tail of TMIGD2 interacts with SH3-containing signaling molecules, such as SPIN90, CACNB2, BPAG1 and MIA, to modulate angiogenesis. CHO cell-derived Recombinant Human TMGID2/CD28H Fc is a glycosylated, disulfide-linked homodimer of 361-amino-acid-residues whose monomer consists of the 128-amino-acid extracellular domain fused to the 231-amino-acid length Fc portion of human IgG1 by two glycine residues. The calculated molecular weight of monomeric Recombinant TMIGD2/CD28H Fc is 40.1kDa; however, due to glycosylation, it migrates at an apparent molecular weight of approximately 55-60 kDa by SDS-PAGE analysis under reducing conditions.

Catalog Number: (103006-800)

Supplier: Anaspec Inc

Description: A Glutamic acid decarboxylase 2 (GAD2) peptide corresponding to residues 206 to 220 of GAD65. GAD2 is presented to T cells in association with I-Ag7 MHC class II molecules. This peptide was also used as a part of Ig chimeras to test whether IL-10 interferes with expression of CTLA-4.
Sequence:TYEIAPVFVLLEYVT
MW:1757.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-238)

Supplier: Anaspec Inc

Description: Indolicidin, a member of the cathelicidin protein family, is a 13-residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. Indolicidin is microbicidal in-vitro against gram-positive and gram-negative bacteria, fungi, protozoa, and human immunodeficiency virus (HIV-1).
Sequence:ILPWKWPWWPWRR-NH2
MW:1906.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: ACROBIOSYSTEMS

Description: Rat IL-2 R beta&IL-2 R gamma Heterodimer Protein, His Tag&Twin-Strep Tag, Source: expressed from human 293 cells (HEK293), Predicted N-terminus: Ala 27 (IL-2RB) & Ser 25 (IL-2RG), Molecular weight: 29.3 kDa/33.6 kDa, Synonyms: IL-2 R beta & IL-2 R gamma, IL-2RB & IL-2RG, Size: 1mg

Catalog Number: (103007-450)

Supplier: Anaspec Inc

Description: This peptide corresponds to the GAP27 domain of connexin. Connexins, or gap junctions, are a family of structurally-related transmembrane proteins. This synthetic connexin-mimetic peptide, Gap 27, was used to evaluate the contribution of gap-junctional communication to osteoclastic bone resorption. It was concluded that gap-junctional communication is necessary for proper bone remodeling.
Sequence:SRPTEKTIFII
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: Removal of any preexisting structures in lyophilized stocks of Aβ-peptide is the critical initial step for controlled aggregation studies. HFIP has been shown to break down β-sheet structure, disrupt hydrophobic forces in aggregated amyloid preparations, and promotes α-helical secondary structure. HFIP treatment of lyophilized Aβ-peptide resulted in a dense, homogeneous preparation of unaggregated peptide and samples can be stored as peptide films.

Catalog Number: (103007-324)

Supplier: Anaspec Inc

Description: This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide. PUMA together with Bcl-xL, and cytoplasmic p53 coordinate p53 functions. PUMA proteins bind Bcl-2, localize to the mitochondria, and induce cytochrome C release and apoptosis in response to p53. PUMA may be a direct mediator of p53-induced apoptosis.
Sequence:EEQWAREIGAQLRRMADDLNAQYER
MW:3049.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Rockland Immunochemical

Description: This mixture contains seven purified proteins that range in size from 14 to 120kDa

Catalog Number: (103003-050)

Supplier: Anaspec Inc

Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (470007-002)

Supplier: Cochranes of Oxford

Description: Excellent for Lessons on Structure and Bonding.

Sale

Catalog Number: (470231-426)

Supplier: Wards

Description: Perfect Starter Set

Sale