You Searched For: Molecular+Bioproducts+Inc.


377,118  results were found

SearchResultCount:"377118"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: ACROBIOSYSTEMS
Description: SARS-CoV-2 (COVID-19) S protein RBD (V367F), His Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS
Description: Biotinylated SARS-CoV-2 S protein, His,Avitag™, Super stable trimer (MALS verified), ACROBiosystems

Supplier: Anaspec Inc
Description: This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4.
Sequence: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 3369.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: ACROBIOSYSTEMS
Description: Biotinylated SARS-CoV-2 (COVID-19) Nucleocapsid protein, His,Avitag™, ACROBiosystems

Supplier: ACROBIOSYSTEMS
Description: SARS-CoV-2 (COVID-19) NSP1 Protein, His Tag, ACROBiosystems

Catalog Number: (EM1.05734.0250)
Supplier: MilliporeSigma

Supplier: ACROBIOSYSTEMS
Description: FITC-Labeled Human ROR1 Protein, Fc Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Human TGF-Beta 1 / TGFB1 Protein, Avitag™, ACROBiosystems

Supplier: ACROBIOSYSTEMS
Description: SARS-CoV-2 (COVID-19) S protein RBD, His Tag (MALS verified), ACROBiosystems

Supplier: Christensen Educational Materials
Description: Construct three-dimensional representations of chemical compounds with these durable, yet inexpensive student molecular model parts. Replace missing pieces from your model sets, or construct your own from the available replacement model pieces.

Catalog Number: (103007-962)
Supplier: Anaspec Inc
Description: This peptide sequence is found in residues 1 to 21 of the histone H3K9(Ac) . H3K9(Ac) is highly localized to the 5’ region of transcription start sites in human genes. Localization of H3K9(Ac)  to the transcriptionally active 5’ region of human genes suggests this peptide is essential for transcription initiation and elongation.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA
MW:2296.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (470231-440)
Supplier: Wards
Description: Tutorial Universal Set


Supplier: ACROBIOSYSTEMS
Description: HCoV-HKU1(isolate N5) S1 protein, His Tag, ACROBiosystems

Catalog Number: (103010-858)
Supplier: Anaspec Inc
Description: Sulforhodamine 101 acid chloride is quite unstable in water, especially at the higher pH required for reaction with aliphatic amines. Protein modification by this reagent is frequently done at low temperature. This reagent reacts with amine compounds such as amino acids, peptides and proteins to give bright red fluorescent conjugates that are extremely stable, and resistant to protease-catalyzed hydrolysis.


Catalog Number: (EM1.05704.0250)
Supplier: MilliporeSigma

Supplier: ACROBIOSYSTEMS
Description: Rat IL-2 R beta&IL-2 R gamma Heterodimer Protein, His Tag&Twin-Strep Tag, Source: expressed from human 293 cells (HEK293), Predicted N-terminus: Ala 27 (IL-2RB) & Ser 25 (IL-2RG), Molecular weight: 29.3 kDa/33.6 kDa, Synonyms: IL-2 R beta & IL-2 R gamma, IL-2RB & IL-2RG, Size: 1mg

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,161 - 2,176 of 377,118
no targeter for Bottom