You Searched For: Molecular+Bioproducts+Inc.

Catalog Number: (76303-722)

Supplier: PeproTech, Inc.

Description: Noggin belongs to a group of diffusible proteins that bind to ligands of the TGF-beta family, and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-beta ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Noggin was originally identified as a BMP-4 antagonist whose action was critical for proper formation of the head and other dorsal structures. Consequently, noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of noggin in mice results in prenatal death, and a recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis. Recombinant Human Noggin is a 46 kDa disulfide-linked homodimer consisting of two 205 amino acid polypeptide chains. Monomeric glycosylated noggin migrates at an apparent molecular weight of approximately 28.0-33.0 kDa by SDS PAGE analysis under reducing conditions.

Sale

Catalog Number: (76303-726)

Supplier: PeproTech, Inc.

Description: DKK-1 is a member of the DKK protein family which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head-forming molecule that behaves as an antagonist for Wnt signaling. Subsequent studies have shown that DKK-1 and DKK-4 play important regulatory roles in the Wnt/beta-catenin signaling pathway by forming inhibitory complexes with LDL receptor-related proteins 5 and 6 (LRP5 and LRP6), which are essential components of the Wnt/beta-catenin signaling system. LPR5 and LPR6 are single-pass transmembrane proteins that appear to act as co-receptors for Wnt ligands involved in the Wnt/beta-catenin signaling cascade. It has been suggested that by inhibiting Wnt/beta-catenin signaling, which is essential for posterior patterning in vertebrates, DKK-1 permits anterior development. This notion is supported by the finding that mice deficient of DKK-1 expression lack head formation and die during embryogenesis. Mature human DKK-1 expressed in HEK293 cells is a 35-40 kDa glycoprotein containing 235 amino acid residues. The calculated molecular weight of Recombinant Human DKK-1 expressed in HEK293 cells is 25.8 kDa.

Sale

Supplier: VWR International

Description: Customizable caps with O-ring, accept colorful cap inserts to organize samples or match kit branding. For use with VWR® screw cap microtubes only (series 76417-xxx).

Certificates

Catalog Number: (103007-180)

Supplier: Anaspec Inc

Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: BeanTown Chemical

Description: CAS: 308080-99-1; MDL No: MFCD00131613 Beads Hygroscopic

SDS

Catalog Number: (EM1.05708.9010)

Supplier: MilliporeSigma

SDS Sale

Catalog Number: (103007-098)

Supplier: Anaspec Inc

Description: This hybrid peptide named colivelin was synthesized to potentiate the neuroprotective effect of humanin (HN). Colivelin is composed of Activity-Dependent Neurotrophic Factor (ADNF) C-terminally fused to AGA-(C8R) HNG17, a potent HN derivative. Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease (FAD)-causative genes and beta-amyloid (1-43). Intraperitoneally administered colivelin suppresses memory impairment and might serve as a novel drug candidate for treatment of Alzheimer's disease.
Sequence:SALLRSIPAPAGASRLLLLTGEIDLP
MW:2645.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Thermo Scientific Chemicals

Description: Grade: NA, Melting Point C. Boiling Point C: NA. 000-00-0. HYGROSCOPIC

SDS Certificates

Catalog Number: (103007-662)

Supplier: Anaspec Inc

Description: This is a histone 4 peptide acetylated at lysine 8. In some studies, this histone modification is thought to predict prognosis of resected non-small-cell lung cancer. This peptide has also been shown to play a role in somatic hypermutation (SHM) possible owing to its modification that likely mediates recruitment of error-prone DNA polymerases at the DNA repair stage of SHM.
Sequence:SGRGKGG-K(Ac)-GLGKGGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin, also known as acyl-Ghrelin (AG), is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3370.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: QUALITY BIOLOGICAL, INC.

Description: DEPC Treated Water is Ultra Pure and prepared by reverse osmosis, passed through fine carbon, de-ionized through two resin beds and serially filtered 1 µm positively charged membranes. The water is subsequently treated with 0.1% (v/v) DEPC (Diethylpyrocarbonate) and incubated and heated overnight at 37°C. Finally, DEPC Treated Water is filtered through a 0.1 µm filter.

Catalog Number: (103007-418)

Supplier: Anaspec Inc

Description: Caloxins are extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 2A1 is a PM Ca2+ pump inhibitor selectively binding to an extracellular domain. It inhibits Ca2+-Mg2+-ATPase in human erythrocyte leaky ghosts. Caloxin 2A1 is active at an extracellular site, the peptide can simply be added exogenously to inhibit the plasma membrane calcium ATPase (PMCA). Related peptides: Caloxin 1A1 (cat# 62605) and Caloxin 3A1 (cat# 62606).
Sequence:VSNSNWPSFPSSGGG
MW:1479.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Honeywell Research Chemicals

Description: Molecular sieves, 4 armstrong, 8-12 mesh, Grade: Analytical, Cas number: 70955-01-0, Molecular Formula: Na12[(AlO2)12(SiO2)12].XH2O, Molar mass: 189.62 g/mol, Synonym: Adsorbent, Container: Poly bottle, Appearance: Light Brown beads, Size: 1KG

SDS Certificates

Supplier: VWR

Description: VividPro™ is a generic fluorescent stain for protein gel electrophoresis that can be used to visualize proteins.

SDS Certificates

Catalog Number: (103008-078)

Supplier: Anaspec Inc

Description: Tat-Glur23Y, scrambled is a control peptide. The synthetic peptide (Tat-Glur23Y), containing tyrosine residues, blocks phosphorylation of alpha-amino-3-hydroxy-5-methyl-isoxazole-4-propionic acid (AMPA) receptor endocytosis. However, the scrambled version does not have blockade properties. Previous studies show that Tat-Glur23Y, scrambled increase stress levels in mice, while Tat-Glur23Y reduces stress when administered.
Sequence: YGRKKRRQRRRVYKYGGYNE
MW: 2634 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103008-536)

Supplier: Anaspec Inc

Description: This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale