Print…

You Searched For: Molecular+Bioproducts+Inc.


377,118  results were found

Refine Results Sort by
SearchResultCount:"377118"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103007-390

Lymphocytic Choreomeningitis Virus (LCMV) 276-286

Catalog Number: (103007-390)
Supplier: Anaspec Inc
Description: This peptide is amino acids 276 to 286 fragment of the lymphocytic choriomeningitis virus (LCMV) glycoprotein (GP), also known as GP276. It is the H-2Db restricted epitope. LCMV has been routinely exploited for the study of adaptive immune responses to viral infection. Fifty to seventy percent of CD8 T cells at the peak of LCMV infection appear to be specific for five LCMV-derived epitopes including GP276.
Sequence:SGVENPGGYCL
MW:1095.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-608

Human [Asn7]-beta-Amyloid (1-42)

Catalog Number: (103007-608)
Supplier: Anaspec Inc
Description: This b-amyloid (1-42) contains the Tottori-Japanese (D7N) mutation where Asp7 is replaced by Asn7. In vitro analysis using beta-amyloid 1 to 40-based mutant peptide reveals that the D7N mutation does not accelerate the nucleation phase but selectively promotes the elongation phase of amyloid fibril formation. The levels of protofibrils generated from D7N beta-amyloid were markedly inhibited despite enhanced fibril formation.
Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103009-166

[Cit17]-Histone H3 (1-21)-GGK,Biotin

Catalog Number: (103009-166)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (1-21) with deimination at Arg17, converting it to Cit (Citrulline). It is biotinylated through a C-terminal GGK linker. Deimination by peptidyl arginine deiminase 4 (PADI4) blocks methylation by the CARM1 methyltransferase and inhibits transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAP-Cit-KQLA-GGK(Biotin)
MW:2724.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-050

[Lys(Ac)16]-Histone H4 (1-25)-GSGSK,Biotin

Catalog Number: (103009-050)
Supplier: Anaspec Inc
Description: This peptide is histone H4 (1-25) with acetylation at Lys16. It is biotinylated through a C-terminal GSGSK linker. Monoacetylation of histone H4 occurs predominantly at Lys16. Loss of monoacetylation at Lys16 is associated with human tumor cells. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGA-K(Ac)-RHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-470231-434

Large-Scale Molecular Model Set, 99 Atoms

Catalog Number: (470231-434)
Supplier: Wards
Description: This large atom, comprehensive set is perfect for modeling space-filling molecules.
Image Unavailable-103008-178

[Lys(Ac)9]-Histone H3 (1-24)

Catalog Number: (103008-178)
Supplier: Anaspec Inc
Description: This Histone 3 peptide is acetylated at lysine residue at 9th position. In a glioblastoma xenograft expressing a O6-methylguanine-DNA methyltransferase (MGMT), increased H3K9-ac was observed in correlation to histone acetylation and MGMT upregulation, thus demonstrating a mechanism driven by chromatin-mediated MGMT upregulation in potentially directing epigenetic therapies to influence the mechanisms of resistance development in glioblastomas.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLATKA
MW:2597 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103887-974

Human Recombinant IL-2 R beta & IL-2 R gamma (from HEK293), Unconjugated

Supplier: ACROBIOSYSTEMS
Description: Human IL-2 R beta&IL-2 R gamma Heterodimer Protein, His Tag&Twin-Strep Tag (MALS verified), Source: expressed from HEK293, Predicted N-terminus: Ala 27 (IL-2RB) & Leu 23 (IL-2RG), Molecular weight: 29.9 kDa (IL-2RB) and 34.1 kDa (IL-2RG), Synonyms: IL-2 R beta & IL-2 R gamma, Size: 100uG

Image Unavailable-103889-174

Cynomolgus Recombinant Mucin-1 (from HEK293), Unconjugated

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus Mucin-1/MUC-1 Protein, Fc Tag, Source: expressed from HEK293. It contains AA Leu 254 - Gly 373, Predicted N-terminus: Leu 254, Molecular weight: 7.2 kDa and 32.8 kDa, Synonyms: Mucin 1, MUC1, CD227, EMA, H23AG, KL-6, MAM6, MUC-1/SEC, MUC-1/X, MUC1/ZD, PEM, PEMT, PUM, Size: 100uG

Image Unavailable-AAAL05722-0B

Molecular sieve A5 (0.5 nm, 5 Å), beads 3-5 mm (0.12-0.20 in)

Supplier: Thermo Scientific Chemicals
Description: Grade: NA, Melting Point C. Boiling Point C: NA. 000-00-0. HYGROSCOPIC

SDS Certificates

Image Unavailable-103006-330

Tyrosinase-Related Protein 2 (180-188)

Catalog Number: (103006-330)
Supplier: Anaspec Inc
Description: This peptide is derived from tyrosinase-related protein 2 (TRP2) residues 180-188. TRP2 belongs to the melanocyte differentiation antigens and has been implicated as a target for immunotherapy of human as well as murine melanoma. Studies show that this TRP2 derived peptide can bind to mouse and human MHC class I molecules. Immunization with TRP2 peptide loaded dendritic cells (DCs) results in effective induction of antitumor immunity.
Sequence:SVYDFFVWL
MW:1175.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-JT4035-5

Orthoboric acid ≥99.5% (by acidimetry), granular, Ultrapure Bioreagent for molecular biology, J.T.Baker®

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: For molecular biology buffers. Lot analysis on label.

SDS Certificates

Product Image-470231-426

Student Inorganic and Organic Molecular Model Set, 65 Pieces

Catalog Number: (470231-426)
Supplier: Wards
Description: Perfect Starter Set
Product Image-76417-198

VWR® Customizable caps for Screw Cap Microtubes

Supplier: VWR International
Description: Customizable caps with O-ring, accept colorful cap inserts to organize samples or match kit branding. For use with VWR® screw cap microtubes only (series 76417-xxx).

Certificates

Image Unavailable-BJ334278-1KG

Molecular sieve 3A (0.3 nm, 3 Å), pellets, Diameter 3.2 mm, Fluka™

Catalog Number: (BJ334278-1KG)
Supplier: Honeywell Research Chemicals
Description: Molecular sieves, 3 A, Analytical, pellets, 3.2 mm diameter, CAS Number: 308080-99-1, Linear Formula: KnNa12-n[(AlO2)12(SiO2)12] a.XH, Pore Size ( armstrong ngstrom) 3, Particle Size 3.2 mm, Adsorbent, Size: 1KG

Certificates


Image Unavailable-BT128945-1KG

Molecular sieve 3A (0.3 nm, 3 Å), beads 1-2 mm (0.04-0.08 in)

Supplier: BeanTown Chemical
Description: CAS: 308080-99-1; MDL No: MFCD00131613 Beads Hygroscopic

SDS

Image Unavailable-103006-550

G209-2M, gp100 (209-217)

Catalog Number: (103006-550)
Supplier: Anaspec Inc
Description: This modified gp100 peptide amino acids 209 to 217 is a MHC-associated HLA-A2.1-restricted epitope derived from melanoma antigen. It can be processed, presented, and recognized by T cells. Alteration of the G209 peptide to G209-2M at the second amino acid changing threonine to a methionine was found to increase the affinity for MHC-associated HLA-A2.1 resulting in enhanced induction of T cells reactive to native gp100
Sequence:IMDQVPFSV
MW:1035.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,113 - 2,128 of 377,118
no targeter for Bottom