You Searched For: BEANTOWN CHEMICAL - BTC


377,118  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"377118"
Description: Human FcRn / FCGRT&B2M Heterodimer Protein, His Tag (SPR & BLI verified), ACROBiosystems
Catalog Number: 103790-360
Supplier: ACROBIOSYSTEMS


Description: The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography followed by GST tag cleavage and removal. The molecular weight of the recombinant DJ-1 protein is 19.9 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.
Catalog Number: 103010-650
Supplier: Anaspec Inc


Description: Molecular sieve A4 (0.4 nm, 4 Å) 4 --> 8 mesh
Catalog Number: TS197260050
Supplier: THERMO FISHER SCIENTIFIC CHEMICALS

New Product


Description: Rat CD3 epsilon&CD3 delta Heterodimer Protein, His Tag&Flag Tag (MALS verified), Source: expressed from human 293 cells (HEK293), Predicted N-terminus: Gln 21 (CD3E) & Phe 22 (CD3D), Molecular weight: 14.9 kDa (CD3E) and 14.5 kDa (CD3D), Synonyms: CD3E & CD3D, CD3 delta & CD3 epsilon, Size: 1mg
Catalog Number: 103888-496
Supplier: ACROBIOSYSTEMS


Description: Selectins are a family of calcium-dependent type 1 transmembrane proteins. Endothelial (E)-selectin is a heavily glycosylated transmembrane protein expressed by activated endothelial cells in microvascular linings. E-selectin, along with P-selectin and L-selectin, initiate recruitment of circulating leukocytes from blood to sites of inflammation in the vascular lining through interaction with specific cell surface-associated carbohydrate determinants. E-selectin consists of an N-terminal type 1 lectin domain, an EGF-like domain, 6 sushi (CCP/SCR) domains, a transmembrane sequence, and a short cytoplasmic domain. Recombinant Human E-selectin is a 58.6 kDa protein containing 535 amino acid residues, corresponding to the extracellular portion of the full length protein. Due to glycosylation, E-selectin migrates at an apparent molecular weight of approximately 65-85 kDa by SDS-PAGE analysis under reducing conditions.
Catalog Number: 10772-864
Supplier: PeproTech, Inc.


Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-180
Supplier: Anaspec Inc


Description: HIGH PURITY SOLVENTS, LC-MS GRADE SOLVENTS
Catalog Number: BJLC323-1
Supplier: Honeywell Research Chemicals

Description: The 1D3 monoclonal antibody specifically reacts with mouse CD19, a 95 kDa transmembrane glycoprotein, a member of the Ig superfamily and a B cell-lineage differentiation antigen expressed by all the B lymphocyte development stages, except for the terminally differentiated plasma cells. CD19 associates with CD21, CD81 and MHC class II to form a multi-molecular complex that initiates the mature B lymphocyte activation by interaction with the B-cell receptors. CD 19 enhances the B cell proliferation, development and activation, and the maturation of memory B cells. In CD19-deficient mice, the generation and maturation of B lymphocytes in the bone marrow and periphery are affected. BG Violet 450 conjugate is an alternative to the Pacific Blue, eFluor 450, or BD Horizon V450 dyes. It is excited by the violet (405 nm) laser, with a peak emission of 450nm.
Catalog Number: 75842-130
Supplier: BIOGEMS INTERNATIONAL INC.


Description: Platelet Activating Factor (PAF) is a biologically active phospholipid, which exerts primarily proinflammatory activities by specifically signaling through G-protein-coupled receptors on platelets, neutrophils, and monocytes. Platelet Activating Factor Acetylhydrolase (PAF-AH) is a secreted protein that mediates PAF activity by specifically catalyzing hydrolysis of the “sn2” ester bond, resulting in the conversion of PAF to the biologically inactive lyso-PAF. PAF-AH can also interact with LDL particles to induce the hydrolysis of LDL-associated, oxidized phospholipids, generating lysophosphatidylcholine (lyso-PC) and other lysophospholipids. Recombinant Human PAF-AH is a 420 amino acid glycoprotein which migrates with an apparent molecular mass of 47-55 kDa by SDS-PAGE analysis. Recombinan Human PAF-AH has a calculated, theoretical meolecular weight of 47.8 kDa.
Catalog Number: 10779-442
Supplier: PeproTech, Inc.


Description: Biotinylated Cynomolgus Fc gamma RIIB / CD32b Protein, His,Avitag™ (SPR & BLI verified), ACROBiosystems
Catalog Number: 103790-212
Supplier: ACROBIOSYSTEMS


Description: This hybrid peptide named colivelin was synthesized to potentiate the neuroprotective effect of humanin (HN). Colivelin is composed of Activity-Dependent Neurotrophic Factor (ADNF) C-terminally fused to AGA-(C8R) HNG17, a potent HN derivative. Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease (FAD)-causative genes and beta-amyloid (1-43). Intraperitoneally administered colivelin suppresses memory impairment and might serve as a novel drug candidate for treatment of Alzheimer's disease.
Sequence:SALLRSIPAPAGASRLLLLTGEIDLP
MW:2645.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-098
Supplier: Anaspec Inc


Description: Molecular sieves, 4 armstrong, 4-8 mesh, Grade: Analytical, Cas number: 70955-01-0, Molecular Formula: Na12[(AlO2)12(SiO2)12].XH2O, Molar mass: 189.62 g/mol, Synonym: Adsorbent, Container: Poly bottle, Appearance: Beige Beads, Size: 1KG
Catalog Number: BJ208590-5KG
Supplier: Honeywell Research Chemicals

SDS


Description: Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin, also known as acyl-Ghrelin (AG), is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3370.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 103003-678
Supplier: Anaspec Inc


Description: This is a histone 4 peptide acetylated at lysine 8. In some studies, this histone modification is thought to predict prognosis of resected non-small-cell lung cancer. This peptide has also been shown to play a role in somatic hypermutation (SHM) possible owing to its modification that likely mediates recruitment of error-prone DNA polymerases at the DNA repair stage of SHM.
Sequence:SGRGKGG-K(Ac)-GLGKGGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-662
Supplier: Anaspec Inc


Description: Caloxins are extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 2A1 is a PM Ca2+ pump inhibitor selectively binding to an extracellular domain. It inhibits Ca2+-Mg2+-ATPase in human erythrocyte leaky ghosts. Caloxin 2A1 is active at an extracellular site, the peptide can simply be added exogenously to inhibit the plasma membrane calcium ATPase (PMCA). Related peptides: Caloxin 1A1 (cat# 62605) and Caloxin 3A1 (cat# 62606).
Sequence:VSNSNWPSFPSSGGG
MW:1479.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-418
Supplier: Anaspec Inc


Description: Molecular sieve A4 (0.4 nm, 4 Å) 8 - 12 mesh
Catalog Number: TS19727-0050
Supplier: THERMO FISHER SCIENTIFIC CHEMICALS


3,105 - 3,120 of 377,118