You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (102999-750)
Supplier: Anaspec Inc
Description: This is amino acids 11 to 22 fragment of the beta-amyloid peptide.
Sequence: EVHHQKLVFFAE
Molecular Weight: 1483.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103011-278)
Supplier: Anaspec Inc
Description: MQAE, Synonym: N-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide, Fluorescent indicator for Cl-, Molecular Weight: 326.2, Spectral Properties: Abs/Em = 350/460 nm, Solvent System: DMSO, CAS number: 162558-52-3, Molecular Formula: C14H16BrNO3, Storage: -20 deg C, Size: 100 mg


Supplier: Strem Chemicals Inc
Description: Palladium Bisdibenzylideneacetone, CAS Number: 32005-36-0, Molecular Formula: C34H28O2Pd, Formula Weight: 575.00, Color and Form: purple powder, Stability: air sensitive, moisture sensitive

Supplier: Thermo Fisher Scientific Chemicals Inc.
Description: 500 gm

Catalog Number: (103011-116)
Supplier: Anaspec Inc
Description: OPA, Synonym: o - Phthaldialdehyde, UltraPure Grade, Fluorogenic indicator for primary amino group; Widely used for quantitation of peptides and proteins, Molecular Weight: 134.1, Spectral Properties: Abs/Em = 334/456 nm, Solvent System: DMSO or DMF, CAS: 643-79-8, MF: C8H6O2, Size: 1 g


Supplier: QUALITY BIOLOGICAL, INC.
Description: EDTA (Ethylenediaminetetraacetic acid), a metal chelator, is widely used in molecular biology as a chemical reagent to reduce nuclease activity (i.e. metalloenzyme). EDTA solution can be used to study cell biology, molecular biology, bioactive small molecules, biochemicals, solutions and reagents, inorganic salts, and chelators.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (102996-340)
Supplier: Anaspec Inc
Description: This is an integrin-binding peptide.
Sequence:GRGDTP
MW:601.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (100200-970)
Supplier: Strem Chemicals Inc
Description: Schrock-Hoveyda Catalyst


Catalog Number: (103003-178)
Supplier: Anaspec Inc
Description: This is a fluorescent (HiLyte™ Fluor 488)-labeled ß-Amyloid peptide, Abs/Em = 503/528 nm.


Supplier: Anaspec Inc
Description: HiLyte™ Fluor594 acid, SE is an amine reactive reagent for labeling peptides, proteins and antibodies.

Supplier: AAT BIOQUEST INC
Description: Calcium measurement is critical for numerous biological investigations.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (76177-610)
Supplier: MICROBIOLOGICS, INC.
Description: Helix Elite™ Molecular Standards (Inactivated Swabs) and QC Sets and Panels - Helix Elite™ Molecular Standards (Inactivated Swabs) are intended for use as external controls for qualitative detection by molecular assays.


Catalog Number: (100200-974)
Supplier: Strem Chemicals Inc
Description: Schrock-Hoveyda Catalyst


Catalog Number: (103007-132)
Supplier: Anaspec Inc
Description: This synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein.
Sequence: FAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 2217.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103003-174)
Supplier: Anaspec Inc
Description: Fluorescent (TAMRA)-labeled ß-Amyloid peptides. Abs/Em=544/572 nm.
Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4742.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Strem Chemicals Inc
Description: Copper chromite, barium promoted (62-64% Cr2CuO4, 22-24% CuO, 6% BaO, 0-4% Graphite, 1% CrO3), 1% Cr2O3), CAS: 12018-10-9, molecular Formula: Cr2CuO4, Color: Black, Form: pellets, Size: 100g

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
193 - 208 of 249,603
no targeter for Bottom