You Searched For: Molecular+Bioproducts+Inc.


377,128  results were found

SearchResultCount:"377128"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: MilliporeSigma
Description: Molecular sieve A4 (0.4 nm, 4 Å), beads Reag. Ph. Eur. ~ 2 mm, Supelco®
Supplier: ACROBIOSYSTEMS
Description: Biotinylated Human ICOS / CD278 (C136S, C137S) Protein, His,Avitag™ (recommended for biopanning), ACROBiosystems

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus CD3E&CD3G Heterodimer Protein, His, Avitag*&Flag Tag (MALS verified), Biotinylated, Source: expressed from HEK293, Predicted N-terminus: Gln 22 (CD3E) & Gln 23 (CD3G), Molecular weight: 17.7 kDa (CD3E) and 15.4 kDa (CD3G), Synonyms: CD3 epsilon & CD3 gamma, CD3E & CD3G, Size: 25uG

Supplier: ACROBIOSYSTEMS
Description: Human IL-31 RA Protein, Fc Tag, ACROBiosystems

Supplier: Anaspec Inc
Description: Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes.
Sequence:RPKPQQFFGLM-NH2
MW:1347.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus CD3 epsilon&CD3 delta Heterodimer Protein, Fc, His Tag&Fc, Flag Tag (MALS verified), Source: expressed from HEK293, Predicted N-terminus: Gln 22 (CD3E) & Phe 22 (CD3D), Molecular weight: 42.5 kDa (CD3E) and 40.9 kDa (CD3D), Synonyms: CD3E & CD3D, CD3 delta & CD3 epsilon, Size: 1mg

Catalog Number: (103007-832)
Supplier: Anaspec Inc
Description: This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.
Sequence:rrrrrrrrGAELPPEFAAQLRKIGDKVYC
MW:3555.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-410)
Supplier: Anaspec Inc
Description: AMARA peptide is a minimal substrate for several members of the protein kinases family. It contains the phosphorylation site for AMP-activated Protein Kinase (AMPK). AMARA peptide may be employed in the applications to measure AMPK-related kinase activity.
Sequence:AMARAASAAALARRR
MW:1542.8 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103009-478)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (1-50) biotinylated through a C-terminal GGK linker. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE-GGK(Biotin)
MW:5809.8 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-102)
Supplier: Anaspec Inc
Description: Mant-ATP is a fluorescent analog of ATP with Ex/Em = 355/448 nm. The fluorescence quantum yield of Mant fluorophore is 0.2 in water which increases significantly in nonpolar solvents or upon binding to most proteins. This highly environmental sensitive fluorescence of Mant makes Mant-ATP useful for directly detecting the nucleotide-protein interactions.


Supplier: ACROBIOSYSTEMS
Description: Human Integrin alpha X beta 2 (ITGAX&ITGB2) Heterodimer Protein, His Tag&Tag Free, Source: expressed from HEK293, Predicted N-terminus: Phe 20 (ITGAX) & Gln 23 (ITGB2), Molecular weight: 126.5 kDa (ITGAX) and 80.2 kDa (ITGB2), Synonyms: Integrin alpha X beta 2, ITGAX&ITGB2, Size: 1mg

Catalog Number: (103008-588)
Supplier: Anaspec Inc
Description: This is a myristoylated form of Autocamtide-2-Related Inhibitory Peptide (AIP), a highly potent and specific substrate competitive inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII). AIP is derived from Autocamtide-2, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALRRQEAVDAL
MW:1708.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-100)
Supplier: Anaspec Inc
Description: Mant-GTP is a fluorescent analog of GTP with Ex/Em = 355/448 nm. The fluorescence quantum yield of Mant fluorophore is 0.2 in water which increases significantly in nonpolar solvents or upon binding to most proteins. This highly environmental sensitive fluorescence of Mant makes Mant-GTP useful for directly detecting the nucleotide-protein interactions.


Catalog Number: (103009-192)
Supplier: Anaspec Inc
Description: This is histone H4 (1-25) with a C-terminal GSGS linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3232.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-492)
Supplier: Anaspec Inc
Description: This is fragment of the myelin basic protein (MBP), which induces moderate experimental autoimmune encephalomyelitis (EAE) symptoms in immunized mice. It corresponds to amino acids 83-96 of the murine sequence (85-98 in guinea pig; 86-99 in human).
Sequence:VVHFFKNIVTPRTP
MW:1655 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-734)
Supplier: Anaspec Inc
Description: This peptide sequence is based on rabbit muscle glycogen synthase with Ser7 phosphorylated. It is a peptide substrate for Casein Kinase I (CK1). CK1 phosphorylates Ser10. Ser7 is phosphorylated by PKA in vivo.
Sequence:KRRRAL-pS-VASLPGL
MW:1603.9 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,001 - 2,016 of 377,128
no targeter for Bottom