Print…

You Searched For: Molecular+Bioproducts+Inc.


377,129  results were found

Refine Results Sort by
SearchResultCount:"377129"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103871-696

Human Recombinant PSMA (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Human PSMA / FOLH1 Protein, Fc Tag, ACROBiosystems

Product Image-TS19724-5000

Molecular sieve 3A (0.3 nm, 3 Å) 4 --> 8 mesh

Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: Molecular sieve 3A (0.3 nm, 3 Å) 4 --> 8 mesh

Image Unavailable-103007-212

Human [Gln22, Asn23]-beta-Amyloid (1-40)

Catalog Number: (103007-212)
Supplier: Anaspec Inc
Description: This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-76012-956

VWR® 3D Cell Culture Dishes and Plates

Supplier: VWR International
Description: The 3D Scaffold for cell culture is able to simulate the three-dimensional structure of mamalian cells

Environmentally Preferable

Image Unavailable-103001-346

Human Recombinant MMP-12 (from E. coli)

Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-12 (macrophage elastase) is involved in smoke-induced emphysema, tumor and other diseases. MMP-12 is secreted as a 54-kDa zymogen and becomes the mature 45-kDa active form after proteolytic cleavage. MMP-12 has a broad range of substrates, including α-1 proteinase inhibitor, α-2 antiplasmin, plasminogen activator inhibitor-2, collagen IV, laminin, fibronectin, elastin, but not interstitial collagens.

The sequence (Accession # NP_002417) corresponding to the catalytic domain (aa 106-267) of Human MMP-12 was expressed in E. coli. The recombinant human MMP-12 was purified from bacterial lysate and refolded using proprietary technique. The molecular weight of the recombinant Human MMP-12 Catalytic Domain is 18 kDa.

Image Unavailable-103834-540

Human Recombinant ACE2 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Human ACE2 / ACEH Protein, His Tag (MALS verified), ACROBiosystems

Image Unavailable-BJ208582-5KG

Molecular sieve 3A (0.3 nm, 3 Å), beads 8-12 mesh, Fluka™

Supplier: Honeywell Research Chemicals
Description: Molecular sieves, 3 armstrong, 8-12 mesh, Adsorbent, Grade: Analytical, Cas number: 308080-99-1, Molecular Formula: KnNa12-n[(AlO2)12(SiO2)12].xH, Molar mass: 189.62 g/mol, Synonym: Molecular Sieve UOP Type 3 armstrong, Container: Poly bottle, Appearance: Beads, Size: 1KG

SDS Certificates

Image Unavailable-EM-MX1583C-4

Molecular sieve 3A (0.3 nm, 3 Å), beads Mesh 4 - 8, Supelco®

Catalog Number: (EM-MX1583C-4)
Supplier: MilliporeSigma
Description: Beads.

SDS Certificates


Image Unavailable-103834-502

SARS-CoV-2 Recombinant NSP7 (from E. coli)

Supplier: ACROBIOSYSTEMS
Description: SARS-CoV-2 (COVID-19) NSP7 Protein, His Tag (MALS verified), ACROBiosystems

Image Unavailable-103834-440

SARS-CoV-2 Recombinant S protein RBD (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: SARS-CoV-2 (COVID-19) S protein RBD (W436R), His Tag, ACROBiosystems

Image Unavailable-103834-524

SARS-CoV-2 Recombinant Envelope protein (from E. coli)

Supplier: ACROBIOSYSTEMS
Description: SARS-CoV-2 (COVID-19) Envelope protein, GST,His Tag, ACROBiosystems

Image Unavailable-103871-784

Human Recombinant uPAR (from HEK293 Cells), Biotin

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Human uPAR / PLAUR Protein, His,Avitag™, ACROBiosystems

Product Image-JTG200-5

Dextran, M.W. ~ 70,000, low fraction, J.T.Baker®

Catalog Number: (JTG200-5)
Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Average molecular weight is 60,000 to 90,000.

SDS Certificates


Image Unavailable-103871-470

SARS-CoV-2 Recombinant S protein RBD (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: SARS-CoV-2 (COVID-19) S protein RBD, His Tag, ACROBiosystems

Image Unavailable-103834-412

SARS-CoV-2 Recombinant S1 protein (from HEK293 cells), Biotin

Supplier: ACROBIOSYSTEMS
Description: Biotinylated SARS-CoV-2 (COVID-19) S1 protein, His,Avitag™ (MALS verified), ACROBiosystems

Image Unavailable-10770-752

Human Recombinant BD1 (from E. coli)

Supplier: PeproTech, Inc.
Description: Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins are distinguished from the β-defensins by the pairing of their three disulfide bonds. To date, six human β-defensins have been identified; BD-1, BD-2, BD-3, BD-4, BD-5 and BD-6. β-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they can act as chemoattractants towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors, and are released by proteolytic cleavage of a signal sequence and, in some cases, a propeptide sequence. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Recombinant Human BD-1 is a 3.9 kDa protein containing 36 amino acid residues.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,985 - 2,000 of 377,129
no targeter for Bottom