Print…

You Searched For: Molecular+Bioproducts+Inc.


377,137  results were found

Refine Results Sort by
SearchResultCount:"377137"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103007-382

[Glu3]-RGES, Control for RGD Peptides

Catalog Number: (103007-382)
Supplier: Anaspec Inc
Description: This peptide is a control for the RGDS Fibronectin Active Fragment and other RGD-related peptides. Asp3 is replaced by Glu3 in RGDS peptide changing its properties to inhibit integrins and proteins of extracellular matrix binding.
Sequence:RGES
MW:447.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103005-896

Moth MCC (88-103)

Catalog Number: (103005-896)
Supplier: Anaspec Inc
Description: This peptide is derived from the carboxyl terminus of moth MCC (88-103) and pigeon cytochrome c plays a major role in T-cell selection. MCC (88-103) can induce positive selection of TCR transgenic thymocytes
Sequence:ANERADLIAYLKQATK
MW:1805.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-EM-MX1583C-4

Molecular sieve 3A (0.3 nm, 3 Å), beads Mesh 4 - 8, Supelco®

Catalog Number: (EM-MX1583C-4)
Supplier: MilliporeSigma
Description: Beads.

SDS Certificates


Image Unavailable-102996-752

W Peptide

Catalog Number: (102996-752)
Supplier: Anaspec Inc
Description: This peptide, containing the consensus sequence XKYX(P/V)M, is found to stimulate phospholipase C (PLC)-mediated formation of InoPs in certain cell lines and human neutrophils. WKYMVm-NH2 may have the ability to activate the microbicidal functions of human neutrophils.
Sequence:WKYMVm-NH2
MW:856.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-268

Drosophila Antennapedia Peptide

Catalog Number: (103006-268)
Supplier: Anaspec Inc
Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:RQIKIWFQNRRMKWKK
MW:2246.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-462

ClearPoint™ Human Ang II Isotope Labeled

Catalog Number: (103008-462)
Supplier: Anaspec Inc
Description: The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed through cleavage of Ang I by the angiotensin-conve
Sequence: DRVY-I*-HPF [I*= I(U13C6,15N)]
MW: 1053.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103006-940

Renin 390 FRET Substrate I

Catalog Number: (103006-940)
Supplier: Anaspec Inc
Description: This peptide is a renin substrate (angiotensinogen) labeled with EDANS/ DABCYL FRET pair for renin activity studies. The renin-angiotensin system (RAS), acting through type 1 angiotensin (AT1) receptors, is a master regulator of fluid homeostasis.
Sequence:R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R
MW:2282.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-350

HOE I40

Catalog Number: (102996-350)
Supplier: Anaspec Inc
Description: Hoe 140 is a stable B2 bradykinin antagonist. Based on its high potency and good tolerability, Hoe 140 is used to evaluate the role of bradykinin in human diseases.
Sequence:rRP-(Hyp)-G-(Thi)-S-(D-Tic)-(Oic)-R
MW:1304.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-468

Human Thrombin Receptor Activator for Peptide 6

Supplier: Anaspec Inc
Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-102996-504

Substance P

Supplier: Anaspec Inc
Description: Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes.
Sequence:RPKPQQFFGLM-NH2
MW:1347.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103889-128

Human Recombinant CD133 (from HEK293), Unconjugated

Supplier: ACROBIOSYSTEMS
Description: Human CD133 Full Length Protein, His Tag (Nanodisc), Source: expressed from HEK293. It contains AA Gly 20 - His 865, Predicted N-terminus: Gly 20, Molecular weight: 24.7 kDa, and it migrates as 25 kDa under reducing (R) condition (SDS-PAGE), Synonyms: CD133, PROM1, PROML1, Size: 20uG

Product Image-TS19724-5000

Molecular sieve 3A (0.3 nm, 3 Å) 4 --> 8 mesh

Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: Molecular sieve 3A (0.3 nm, 3 Å) 4 --> 8 mesh

Image Unavailable-103007-832

Noxa BH3, Peptide 1

Catalog Number: (103007-832)
Supplier: Anaspec Inc
Description: This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.
Sequence:rrrrrrrrGAELPPEFAAQLRKIGDKVYC
MW:3555.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-410

AMARA peptide

Catalog Number: (103007-410)
Supplier: Anaspec Inc
Description: AMARA peptide is a minimal substrate for several members of the protein kinases family. It contains the phosphorylation site for AMP-activated Protein Kinase (AMPK). AMARA peptide may be employed in the applications to measure AMPK-related kinase activity.
Sequence:AMARAASAAALARRR
MW:1542.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-478

Histone H3 (1-50)-GGK, Biotin

Catalog Number: (103009-478)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (1-50) biotinylated through a C-terminal GGK linker. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE-GGK(Biotin)
MW:5809.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-188

MBP (68–86)

Catalog Number: (103007-188)
Supplier: Anaspec Inc
Description: This peptide corresponds to the myelin basic protein (MBP) encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats. It corresponds to amino acids 69-85 from guinea pig MBP.
Sequence:YGSLPQKSQRSQDENPV
MW:1933.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,969 - 1,984 of 377,137
no targeter for Bottom