You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103011-356)
Supplier: Anaspec Inc
Description: Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavage


Supplier: AAT BIOQUEST INC
Description: Calcium measurement is critical for numerous biological investigations.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (103011-414)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 532 hydrazide is a carbonyl-reactive fluorescent labeling dye.


Supplier: GRANT USA INC.
Description: For Molecular Biology And Biotechnology Applications: Universal Block For Standard 96-Well Plates (U-Well, V-Well, Flat Bottom, High Temperature).

Catalog Number: (103010-206)
Supplier: Anaspec Inc
Description: DiSBAC2(3) [[Bis-(1,3-diethylthiobarbituric acid)trimethine oxonol]], Purity: >99% HPLC/TLC, Molecular Formula: C19H24N4O4S2, MW: 436.5, Appearance: Purple solid, Sensitive membrane potential probe, less temperature-dependent than DiBAC, Storage: -20 deg C, Size: 25 mg


Supplier: Teknova
Description: Teknova buffers are specifically formulated to comply with current molecular biology protocols.

Catalog Number: (103010-878)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488 amine is a carbonyl-reactive fluorescent labeling dye.


Catalog Number: (103011-332)
Supplier: Anaspec Inc
Description: Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavag


Catalog Number: (103007-256)
Supplier: Anaspec Inc
Description: This synthetic peptide corresponds to ß--Amyloid (1-40) with an additional cysteine at the C-terminus.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Innovative Research Inc
Description: Immobilized bovine trypsin is ideal for digestions of proteins and peptides.

Supplier: Anaspec Inc
Description: This is scrambled control peptide used in studies to compare the effects of Beta-Amyloid (1-42).
Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Molecular Weight: 4514.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc
Description: 6-TAMRA is the other purified single isomer of 5(6)-TAMRA. It is predominantly used for nucleotide labeling.

Catalog Number: (102999-750)
Supplier: Anaspec Inc
Description: This is amino acids 11 to 22 fragment of the beta-amyloid peptide.
Sequence: EVHHQKLVFFAE
Molecular Weight: 1483.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: SCIENTIFIC SPECIALTIES, INC.
Description: SSIbio Centrifuge Tubes are ideal for everyday centrifugation and storage use.

Supplier: Thermo Fisher Scientific Chemicals Inc.
Description: 500 gm

Supplier: AGILENT TECHNOLOGIES, INC (CSD)
Description: A high-polarity and highly substituted cyanopropyl low-bleed phase suited for the analysis of high molecular weight compounds

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
177 - 192 of 249,603
no targeter for Bottom