Print…

You Searched For: Molecular+Bioproducts+Inc.


377,159  results were found

Refine Results Sort by
SearchResultCount:"377159"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103006-558

Mouse mCRAMP

Catalog Number: (103006-558)
Supplier: Anaspec Inc
Description: This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Sequence:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
MW:3878.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103005-892

Human Thrombin Receptor Activator for Peptide

Catalog Number: (103005-892)
Supplier: Anaspec Inc
Description: This is a negative control peptide containing the reversed sequence of the first two amino acids of the receptor-activating (tethered ligand) peptide SFLLRN-NH2. It shows no detectable affinity for the binding sites.
Sequence:FSLLRN-NH2
MW:747.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103013-634

Mouse Recombinant PD-L1 (from HEK293 Cells), Biotin, Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Biotinylated PD-L1/B7-H1, Fc Tag, Avitag*, Host: HEK293 cells, Species Reactivity: Mouse, Purity: >95%(SDS-PAGE), Molecular Characterization: Carries IgG1 Fc fragment at C-terminus, followed by an Avitag*, MW 53.2KDa, Synonym: PD-L1,CD274, Size: 200ug

Image Unavailable-103815-242

Mouse Recombinant FcRn (FCGRT & B2M) (from HEK293 Cells), Biotin

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Mouse FcRn / FCGRT&B2M Heterodimer Protein, His,Avitag™ (BLI verified), ACROBiosystems

Image Unavailable-103012-346

Cynomolgus macaque;Rhesus macaque Recombinant B7-1 (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus B7-1/CD80 Protein, Host: HEK293 cells,Species reactivity: Cynomolgus, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 50.5 kDa, Synonym: CD80,B7,B7-1,B7.1,BB1,CD28LG, Size: 100ug

Image Unavailable-103006-686

Chicken OVA (257-264), FAM (Carboxyfluorescein)

Catalog Number: (103006-686)
Supplier: Anaspec Inc
Description: This is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb. It is fluorescent (5-FAM)-labeled, Abs/Em=494/521 nm.
Sequence: 5-FAM-SIINFEKL-NH2
MW: 1320.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103014-138

Human Recombinant CD27 (from HEK293 Cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: CD27/TNFRSF7 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >95%(SDS-PAGE), Molecular Characterization: Fc Tag fused with human IgG1 Fc tag at C-terminus, MW 45.9KDa, Synonym: CD27,TNFRSF7,S152,S152. LPFS2, Storage: 4 deg C, Size: 200ug

Image Unavailable-103014-990

Human Recombinant HGF R (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: HGF R / c-MET Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: human IgG1 at the C-terminus, MW of 32.5 kDa, Less than 1.0 EU per ug , Synonym: MET,AUTS9,HGFR,RCCP2,c-Met, Storage: 4 deg C, Size: 200UG

Image Unavailable-103014-110

Human Recombinant B7-2 (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: B7-2/CD86 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: Fc Tag fused with human IgG1 Fc tag at C-terminus, MW 51.5KDa, Synonyms: CD86,B7-2,B70,CD28LG2,LAB72, Storage: 4 deg C, Size: 200ug

Image Unavailable-103014-270

Cynomolgus macaque;Rhesus macaque Recombinant CTLA-4 (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: CTLA-4 Protein, Fc Tag, Host: HEK293 Cell, Species Reactivity: Cynomolgus, Purity: >95%, Molecular Characterization: Fc Chimera is fused, MW of 40 kDa, Less than 1.0 EU per ug , Synonym: CTLA4,CD152,CELIAC3,GRD4,GSE,ICOS,IDDM12, Storage: 4 deg C, Size: 1MG

Image Unavailable-103834-558

Cynomolgus monkey Recombinant ACE2 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus ACE2 / ACEH Protein, His Tag, ACROBiosystems

Image Unavailable-103014-542

Human Recombinant IgG4 Fc (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: IgG4 Fc Protein, Tag Free, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: Human IgG4 Fc, Tag Free contains no tag, MW of 25.8 kDa, Less than 1.0 EU per ug , Synonym: IgG4 Fc, IGHG4, Storage: 4 deg C, Size: 1MG

Image Unavailable-103012-996

Human Recombinant Fas (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Fas/TNFRSF6/CD95 Protein, Fc Tag, Host: HEK293 Cells, Species: Human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW 42.8 kDa, Synonym: FAS, ALPS1A, APO1, APT1, CD95, Size: 1mg

Image Unavailable-103013-442

Human Recombinant BMPR-IA (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: BMPR-IA/ALK-3 Protein, Fc Tag, Host: HEK293 Cells, Species reactivity: Human, Purity: >98% SDS-PAGE, Molecular Characterization: Fc Tag is Fused with a human IgG1 Fc tag at the C-terminus, MW of 42 kDa, Synonym: BMPR-1A, ALK-3, 10q23del, Size: 200ug

Image Unavailable-103014-720

Human Recombinant IL-1 beta (from E. coli)

Catalog Number: (103014-720)
Supplier: ACROBIOSYSTEMS
Description: IL-1 beta / IL-1F2 Protein, Tag Free, Host: E.coli, Species Reactivity: Human, purity: >97%, Molecular Characterization: ag Free contains no tag, MW of 17.5 kDa, Less than 1.0 EU per ug , Synonym: IL1B,IL-1BETA,IL1F2,IL-1B, Storage: 4 deg C, Size: 50UG
Product Image-TS19725-5000

Molecular sieve 3A (0.3 nm, 3 Å) 8-12 mesh

Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: Molecular sieves 3A, 8 to 12 mesh, Size: 5kg

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,873 - 1,888 of 377,159
no targeter for Bottom