Print…

You Searched For: Molecular+Bioproducts+Inc.


377,211  results were found

Refine Results Sort by
SearchResultCount:"377211"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103013-632

Mouse Recombinant PD-L1 (from HEK293 Cells), Biotin, Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Biotinylated PD-L1/B7-H1, Fc Tag, Avitag*, Host: HEK293 cells, Species Reactivity: Mouse, Purity: >95%(SDS-PAGE), Molecular Characterization: Carries IgG1 Fc fragment at C-terminus, followed by an Avitag*, MW 53.2KDa, Synonym: PD-L1,CD274, Size: 25ug

Image Unavailable-103815-242

Mouse Recombinant FcRn (FCGRT & B2M) (from HEK293 Cells), Biotin

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Mouse FcRn / FCGRT&B2M Heterodimer Protein, His,Avitag™ (BLI verified), ACROBiosystems

Image Unavailable-103012-346

Cynomolgus macaque;Rhesus macaque Recombinant B7-1 (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus B7-1/CD80 Protein, Host: HEK293 cells,Species reactivity: Cynomolgus, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW of 50.5 kDa, Synonym: CD80,B7,B7-1,B7.1,BB1,CD28LG, Size: 100ug

Image Unavailable-103007-680

Rat C-Peptide-1

Catalog Number: (103007-680)
Supplier: Anaspec Inc
Description: This is amino acid sequence of rat C-peptide-1. C-peptide binds specifically to cell surfaces, probably to a G protein-coupled surface receptor, with subsequent activation of Ca2+-dependent intracellular signaling pathways. It also stimulates Na+-K+-ATPase and endothelial nitric oxide synthase activities. Rat C-peptide was found to diminish glucose-stimulated insulin release in rats both in vivo and in vitro.
Sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ
MW: 3259.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103014-112

Human Recombinant B7-2 (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: B7-2/CD86 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: Fc Tag fused with human IgG1 Fc tag at C-terminus, MW 51.5KDa, Synonyms: CD86,B7-2,B70,CD28LG2,LAB72, Storage: 4 deg C, Size: 1mg

Image Unavailable-103014-992

Human Recombinant HGF R (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: HGF R / c-MET Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: human IgG1 at the C-terminus, MW of 32.5 kDa, Less than 1.0 EU per ug , Synonym: MET,AUTS9,HGFR,RCCP2,c-Met, Storage: 4 deg C, Size: 1MG

Image Unavailable-103014-138

Human Recombinant CD27 (from HEK293 Cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: CD27/TNFRSF7 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, Purity: >95%(SDS-PAGE), Molecular Characterization: Fc Tag fused with human IgG1 Fc tag at C-terminus, MW 45.9KDa, Synonym: CD27,TNFRSF7,S152,S152. LPFS2, Storage: 4 deg C, Size: 200ug

Image Unavailable-103007-606

Human [Arg6]-beta-Amyloid (1-42)

Catalog Number: (103007-606)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4533.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103014-270

Cynomolgus macaque;Rhesus macaque Recombinant CTLA-4 (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: CTLA-4 Protein, Fc Tag, Host: HEK293 Cell, Species Reactivity: Cynomolgus, Purity: >95%, Molecular Characterization: Fc Chimera is fused, MW of 40 kDa, Less than 1.0 EU per ug , Synonym: CTLA4,CD152,CELIAC3,GRD4,GSE,ICOS,IDDM12, Storage: 4 deg C, Size: 1MG

Image Unavailable-103834-558

Cynomolgus monkey Recombinant ACE2 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus ACE2 / ACEH Protein, His Tag, ACROBiosystems

Image Unavailable-103014-540

Human Recombinant IgG4 Fc (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: IgG4 Fc Protein, Tag Free, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: Human IgG4 Fc, Tag Free contains no tag, MW of 25.8 kDa, Less than 1.0 EU per ug , Synonym: IgG4 Fc, IGHG4, Storage: 4 deg C, Size: 200UG

Image Unavailable-103790-626

Mouse Recombinant Integrin alpha V beta 8 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Mouse Integrin alpha V beta 8 (ITGAV&ITGB8) Heterodimer Protein, His Tag&Tag Free, ACROBiosystems

Image Unavailable-103006-902

S. pneumoniae CFP10 (71–85)

Catalog Number: (103006-902)
Supplier: Anaspec Inc
Description: This 15-mer peptide is fragment of (CFP)10 protein, which is secreted from mycobacterium tuberculosis 10-kDa culture filtrate stimulate IFN-gamma; production and CTL activity by CD4+ and CD8+ cells, from persons expressing a spectrum of MHC molecules. This peptide is an excellent candidate for inclusion in a subunit antituberculosis vaccine.
Sequence:EISTNIRQAGVQYSR
MW:1721.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103012-996

Human Recombinant Fas (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Fas/TNFRSF6/CD95 Protein, Fc Tag, Host: HEK293 Cells, Species: Human, Purity: >95% SDS-PAGE, Molecular Characterization: Fc Tag is fused with a human IgG1 Fc tag at the C-terminus, MW 42.8 kDa, Synonym: FAS, ALPS1A, APO1, APT1, CD95, Size: 1mg

Image Unavailable-103013-442

Human Recombinant BMPR-IA (from HEK293 cells), Fc Tag

Supplier: ACROBIOSYSTEMS
Description: BMPR-IA/ALK-3 Protein, Fc Tag, Host: HEK293 Cells, Species reactivity: Human, Purity: >98% SDS-PAGE, Molecular Characterization: Fc Tag is Fused with a human IgG1 Fc tag at the C-terminus, MW of 42 kDa, Synonym: BMPR-1A, ALK-3, 10q23del, Size: 200ug

Image Unavailable-103790-268

Mouse Recombinant CD27 Ligand (from HEK293 cells), Biotin

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Mouse CD27 Ligand / CD70 Protein, His,Avitag™, ACROBiosystems

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,809 - 1,824 of 377,211
no targeter for Bottom