You Searched For: Molecular+Bioproducts+Inc.

Catalog Number: (103008-602)

Supplier: Anaspec Inc

Description: This is a substrate peptide for Interleukin-1 Receptor-Associated Kinase (IRAK) 4, derived from the IRAK-1 activation loop peptide amino acids 360 to 380. This peptide sequence contains Ser-376, one of the primary phospho-acceptor residues of IRAK-1. IRAK-4 phosphorylates IRAK-1 as a key step in regulation of inflammatory signaling pathways.
Sequence:KKARFSRFAGSSPSQSSMVAR
MW:2285.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103003-364)

Supplier: Anaspec Inc

Description: Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
(Disulfide bridge: 5-34, 12-27, 17-35)
MW:3929.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103790-198)

Supplier: ACROBIOSYSTEMS

Description: Mouse CD47 Protein, Mouse IgG2a Fc Tag, low endotoxin, ACROBiosystems

Sale

Supplier: ACROBIOSYSTEMS

Description: PD-L1/B7-H1 Protein, Host: HEK293, Species Reactivity: Cynomolgus, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 27.1 kDa, Synonym: PD-L1,CD274,B7-H1,PDCD1L1,PDCD1LG1, Storage: 4 deg C, Size: 1mg

Supplier: ACROBIOSYSTEMS

Description: B7-2/CD86 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Cynomolgus, Purity: 95%(SDS-PAGE), Molecular Characterization: Fc Chimera fused with human IgG1 Fc tag at C-terminus, MW 52KDa, Synonyms: CD86,B7-2,B70,CD28LG2, Storage: 4 deg C, Size: 100ug

Supplier: Anaspec Inc

Description: Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), Cat AS-20610, is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYP
MW: 2933.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: ACROBIOSYSTEMS

Description: B7-2/CD86 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Mouse, Purity: >95% (SDS-PAGE), Molecular Characterization: Fc Tag fused with human IgG1 Fc tag at C-terminus, MW 52KDa, Synonyms: CD86,B7-2,B70,CD28LG2,LAB72, Storage: 4 deg C, Size: 1mg

Supplier: ACROBIOSYSTEMS

Description: Human CD20 / MS4A1 Full Length Protein, His Tag (HEK293) (SPR verified), ACROBiosystems

Supplier: PeproTech, Inc.

Description: TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling and maintenance of a variety of other tissues and organs. BMP-3 is abundantly found in adult bone and, to a lesser extent, fetal cartilage. BMP-3 inhibits osteogenesis and bone formation by activating a signaling cascade that antagonizes the signaling of pro-osteogenic BMPs. Recombinant Human BMP-3 is a disulfide-linked homodimeric protein that corresponds to residues 361 to 472 of the 472 amino acid BMP-3 precursor protein. The calculated molecular weight of Recombinant Human BMP-3 is 25.2 kDa.

Supplier: PeproTech, Inc.

Description: The IGFs are mitogenic, polypeptide growth factors that stimulate the proliferation and survival of various cell types, including muscle, bone, and cartilage tissue in vitro . IGFs are predominantly produced by the liver, although a variety of tissues produce the IGFs at distinctive times. The IGFs belong to the Insulin gene family, which also contains insulin and relaxin. The IGFs are similar to insulin by structure and function, but have a much higher growth-promoting activity than insulin. IGF-II expression is influenced by placenta lactogen, while IGF-I expression is regulated by growth hormone. Both IGF-I and IGF-II signal through the tyrosine kinase type I receptor (IGF-IR), but IGF-II can also signal through the IGF-II/Mannose-6-phosphate receptor. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contain N-terminal and C-terminal propeptide regions. Recombinant Murine IGF-I is a 7.6 kDa globular protein containing amino acids including 3 intra-molecular disulfide bonds.

Catalog Number: (103008-148)

Supplier: Anaspec Inc

Description: This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.
Sequence: YGRKKRRQRRRAKEGANVAG
MW: 2357.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Supplier: ACROBIOSYSTEMS

Description: Human DLL4 Protein, Fc Tag, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with Fc fragment of human IgG1 at the C-terminus, MW of 81 kDa, Endotoxin: Less than 1.0 EU per ug of the rh DLL4 Fc Chimera, size: 1mg

Catalog Number: (103008-728)

Supplier: Anaspec Inc

Description: This linear peptide is derived from the C-terminus of the chemokine, complement fragment 5 anaphylatoxin (C5a). This peptide functions to inhibit C5a binding and function at human and rat C5a receptors. C5a is crucial to triggering cellular immune responses and its overexpression is involved in arthritis, Alzheimer’s disease, cystic fibrosis, systemic lupus erythematosus, and other immunoinflammatory diseases
Sequence:FKP-(D-Cha)-Wr
MW:886.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: ACROBIOSYSTEMS

Description: Human Glypican 3 / GPC3 Protein, Llama IgG2b Fc Tag, low endotoxin, ACROBiosystems

Supplier: ACROBIOSYSTEMS

Description: Human GM-CSF R alpha Protein, Fc Tag, ACROBiosystems

Supplier: ACROBIOSYSTEMS

Description: Biotinylated Human IL-15 R alpha / CD215 Protein, Fc,Avitag™, ACROBiosystems