Print…

You Searched For: 3-(Boc-amino)phenylboronic acid


613,137  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613137"

Rate These Search Results

Image Unavailable-10772-872

Recombinant Human VAP-1

Description: Recombinant Human VAP-1, 737 amino acid polypeptide, corresponding to amino acids 27 to 763 of the VAP-1 precursor, source: CHO cells, Purity: >98%, Synonyms: Vascular Adhesion Protein-1, AOC3, SSAO, HPAO, Copper Amine Oxidase, Membrane Primary Amine Oxidase, 10ug
Catalog Number: 10772-872
Supplier: PeproTech, Inc.
Image Unavailable-10772-878

Recombinant Human VAP-1

Description: Recombinant Human VAP-1, 737 amino acid polypeptide, corresponding to amino acids 27 to 763 of the VAP-1 precursor, source: CHO cells, Purity: >98%, Synonyms: Vascular Adhesion Protein-1, AOC3, SSAO, HPAO, Copper Amine Oxidase, Membrane Primary Amine Oxidase, 250ug
Catalog Number: 10772-878
Supplier: PeproTech, Inc.
Image Unavailable-10772-874

Recombinant Human VAP-1

Description: Recombinant Human VAP-1, 737 amino acid polypeptide, corresponding to amino acids 27 to 763 of the VAP-1 precursor, source: CHO cells, Purity: >98%, Synonyms: Vascular Adhesion Protein-1, AOC3, SSAO, HPAO, Copper Amine Oxidase, Membrane Primary Amine Oxidase, 50ug
Catalog Number: 10772-874
Supplier: PeproTech, Inc.
Image Unavailable-103006-504

Beta-Amyloid (1-40)-Lys(Biotin)-NH2 Human 0.1 mg

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Molecular weight: 4683.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg
Catalog Number: 103006-504
Supplier: Anaspec Inc
Image Unavailable-103790-176

Recom Cd94 > 90% Human 19.1 Kda 1Mg

Description: CD94 Recombinant, Purity: > 90%, Species Reactivity: Human, Source: HEK293, Molecular Weight: 19.1 kDa, Tag: polyhistidine tag, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: KLRD1, KP43, NK cell receptor, Size: 1mg
Catalog Number: 103790-176
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-174

Recom Cd94 > 90% Human 19.1 Kda 100Ug

Description: CD94 Recombinant, Purity: > 90%, Species Reactivity: Human, Source: HEK293, Molecular Weight: 19.1 kDa, Tag: polyhistidine tag, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: KLRD1, KP43, NK cell receptor, Size: 100ug
Catalog Number: 103790-174
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-870

Human LBP /Lipopolysaccharide Protein

Description: LBP /Lipopolysaccharide Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 52.8 kDa, Synonym: Lambda Chain Binding Protein,Lambda Binding Protein,LBP, Storage: 4 deg C, Size: 100UG
Catalog Number: 103014-870
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-806

Human Osteoprotegerin/TNFRSF11B Protein

Description: Osteoprotegerin/TNFRSF11B Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 44.4KDa, Synonyms: TNFRSF11B,OCIF, Storage: 4 deg C, Size: 1mg
Catalog Number: 103013-806
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-808

Human Osteoprotegerin/TNFRSF11B Protein

Description: Osteoprotegerin/TNFRSF11B Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95%(SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 44.4KDa, Synonyms: TNFRSF11B,OCIF, Storage: 4 deg C, Size: 100ug
Catalog Number: 103013-808
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-358

Human Mesothelin/MSLN (296-580) 200ug

Description: Mesothelin/MSLN(296-580), Biotinylated, ultrasensitivity(primaryaminelabeling), Host: HEK293 Cells, Species reactivity: Human, Purity: >95% SDS-PAGE, Molecular Characterization: Carries a human IgG1 Fc fragment at N-terminus, Synonym: MPF, Size: 200ug
Catalog Number: 103013-358
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-360

Human Mesothelin/MSLN (296-580) 25ug

Description: Mesothelin/MSLN(296-580), Biotinylated, ultrasensitivity(primaryaminelabeling), Host: HEK293 Cells, Species reactivity: Human, Purity: >95% SDS-PAGE, Molecular Characterization: Carries a human IgG1 Fc fragment at N-terminus, Synonym: MPF, Size: 25ug
Catalog Number: 103013-360
Supplier: ACROBIOSYSTEMS
Product Image-89032-294

GEL BOX, MIDIPLUS, 15 X 10 CM

Catalog Number: 89032-294
Supplier: VWR International
Image Unavailable-103015-454

Biotinylated SOST/Sclerostin 25ug

Description: Biotinylated SOST/Sclerostin, ultra sensitivity (primary amine labeling), Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: carries a polyhistidine tag at N-terminus, MW of 22.5 kDa, Synonym: SOST,VBCH, Size: 25ug
Catalog Number: 103015-454
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-452

Biotinylated SOST/Sclerostin 200ug

Description: Biotinylated SOST/Sclerostin, ultra sensitivity (primary amine labeling), Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: carries a polyhistidine tag at N-terminus, MW of 22.5 kDa, Synonym: SOST,VBCH, Size: 200ug
Catalog Number: 103015-452
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-234

Human CD300LG/Nepmucin Protein 1MG

Description: CD300LG / Nepmucin Protein, Host: HEK293 Cell, Species Reactivity: Human, Purity: >95%, Molecular Characterization: Fused with 6xHis tag at the C-terminus, MW of 25.6 kDa, Synonym: CD300LG, CLM9, TREM4, CD300g, Nepmucin, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-234
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-236

Human CD300LG/Nepmucin Protein 100UG

Description: CD300LG / Nepmucin Protein, Host: HEK293 Cell, Species Reactivity: Human, Purity: >95%, Molecular Characterization: Fused with 6xHis tag at the C-terminus, MW of 25.6 kDa, Synonym: CD300LG, CLM9, TREM4, CD300g, Nepmucin, Storage: 4 deg C, Size: 100UG
Catalog Number: 103014-236
Supplier: ACROBIOSYSTEMS
1 - 16 of 613,137