You Searched For: Rego+X-ray+GmbH


613,137  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"613137"
Catalog Number: 76620-450
Supplier: VWR International


Catalog Number: 76620-456
Supplier: VWR International


Catalog Number: 76620-458
Supplier: VWR International


Catalog Number: 76620-452
Supplier: VWR International


Description: Mm 2-10 21489 1Mg, MM 2-10 (FM 2-10) is the abbreviation of our Membrane Marker 2-10, chemically called N-(3-triethylammoniumpropyl)-4-(4-(diethylamino)styryl)pyridinium dibromide. In literature this membrane marker is also called "FM 2-10" (FM/reg; is the trademark of Molecular Probes), Size: 1mg
Catalog Number: 76483-402
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Description: B7-1/CD80 Protein, (HPLC-verified), Host: HEK293 Cells, Species reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: Fused with a human IgG1 Fc tag at the C-terminus, Molecular weight of 50 kDa, Synonym: CD80, B7, Size: 1mg
Catalog Number: 103013-514
Supplier: ACROBIOSYSTEMS


Description: H-D-Val-Leu-Arg-AFC, Purity: HPLC >/= 95%, Molecular Weight: 597.5, Sequence: vLR-AFC, Appearance: Powder, This is a fluorescent glandular kallikrein substrate, Abs/Em=380/500 nm, Storage: -20 deg C, Size: 10 mg
Catalog Number: 102996-446
Supplier: Anaspec Inc


Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 500UG
Catalog Number: 10779-246
Supplier: PeproTech, Inc.


Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 100UG
Catalog Number: 10779-242
Supplier: PeproTech, Inc.


Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 250UG
Catalog Number: 10779-244
Supplier: PeproTech, Inc.


Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 1MG
Catalog Number: 10779-248
Supplier: PeproTech, Inc.


Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 25UG
Catalog Number: 10779-240
Supplier: PeproTech, Inc.


Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 5UG
Catalog Number: 10779-238
Supplier: PeproTech, Inc.


Description: Beta - Amyloid (1 - 40). HCl, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. HCl, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9.36.5, exert toxic effects on hippocampal cultured neurons, Size: 0.5 mg
Catalog Number: 102999-432
Supplier: Anaspec Inc


Description: Beta-Amyloid (1-40). HCl, Human, Purity: HPLC >/= 95%, Molecular Weight: 4329.9.36.5, Appearance: Powder, They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity, Storage: -20 deg C, Size: 1mg
Catalog Number: 102996-092
Supplier: Anaspec Inc


Description: Her2 / ErbB2 Protein, Species Reactivity: Cynomolgus Her2, Host: HEK293, Purity: >95%, Molecular Weight: 72.9 kDa, Molecular Characterization: protein carries polyhistidine tag at Cterminus, Conjugate: Biotin, Synonym: ERBB2, Storage: 20deg C, Size: 25ug
Catalog Number: 103815-372
Supplier: ACROBIOSYSTEMS


2,817 - 2,832 of 613,137