Print…

You Searched For: Molecular+Bioproducts+Inc.


613,138  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613138"

Rate These Search Results

Image Unavailable-103013-954

Biotinylated Human VEGF165 200ug

Description: Biotinylated VEGF165, epitope tag free, ultra sensitivity (primary amine labeling), Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: No epitope tags, migrates as 24KDa, Synonyms: MGC70609, Size: 200ug
Catalog Number: 103013-954
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-152

Human GITR/TNFRSF18 Protein 100ug

Description: GITR/TNFRSF18 Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >92% as determined by SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at the C-terminus, MW of 15.4 kDa, Synonym: AITR, GITR, TNFRSF18, CD357, Size: 100ug
Catalog Number: 103013-152
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-150

Human GITR/TNFRSF18 Protein 1mg

Description: GITR/TNFRSF18 Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >92% as determined by SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at the C-terminus, MW of 15.4 kDa, Synonym: AITR, GITR, TNFRSF18, CD357, Size: 1mg
Catalog Number: 103013-150
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-230

PTH1R/PTHR1 Protein 100ug

Description: PTH1R/PTHR1 Protein, Host: HEK293, Species Reactivity: Human, Purity: >95% as determined by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 19.3 kDa, Synonym: PTH1R,PTHR,PTHR1, Storage: 4 degree C, Size: 100ug
Catalog Number: 103015-230
Supplier: ACROBIOSYSTEMS
Image Unavailable-10779-246

Recombinant Human GASP-1

Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 500UG
Catalog Number: 10779-246
Supplier: PeproTech, Inc.
Image Unavailable-10779-242

Recombinant Human GASP-1

Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 100UG
Catalog Number: 10779-242
Supplier: PeproTech, Inc.
Image Unavailable-10779-244

Recombinant Human GASP-1

Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 250UG
Catalog Number: 10779-244
Supplier: PeproTech, Inc.
Image Unavailable-10779-248

Recombinant Human GASP-1

Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 1MG
Catalog Number: 10779-248
Supplier: PeproTech, Inc.
Image Unavailable-10779-240

Recombinant Human GASP-1

Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 25UG
Catalog Number: 10779-240
Supplier: PeproTech, Inc.
Image Unavailable-10779-238

Recombinant Human GASP-1

Description: Recombinant Human GASP-1, 542 AA protein, Growth and differentiation factor-associated serum protein-1 is a secreted inhibitory TGF-Beta binding protein, Source: CHO cells, >95%, Synonyms: GDF-associated serum protein-1, GASP, KIAA0443, WFIKKNRP, 5UG
Catalog Number: 10779-238
Supplier: PeproTech, Inc.
Image Unavailable-102996-446

H-D-Val-Leu-Arg-AFC 10 mg

Description: H-D-Val-Leu-Arg-AFC, Purity: HPLC >/= 95%, Molecular Weight: 597.5, Sequence: vLR-AFC, Appearance: Powder, This is a fluorescent glandular kallikrein substrate, Abs/Em=380/500 nm, Storage: -20 deg C, Size: 10 mg
Catalog Number: 102996-446
Supplier: Anaspec Inc
Image Unavailable-102999-432

Beta - Amyloid (1 - 40). HCl 0.5 mg

Description: Beta - Amyloid (1 - 40). HCl, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. HCl, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9.36.5, exert toxic effects on hippocampal cultured neurons, Size: 0.5 mg
Catalog Number: 102999-432
Supplier: Anaspec Inc
Image Unavailable-102996-092

Beta-Amyloid (1-40) 1 mg

Description: Beta-Amyloid (1-40). HCl, Human, Purity: HPLC >/= 95%, Molecular Weight: 4329.9.36.5, Appearance: Powder, They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity, Storage: -20 deg C, Size: 1mg
Catalog Number: 102996-092
Supplier: Anaspec Inc
Image Unavailable-103015-192

PLAU/uPA Protein 50ug

Description: PLAU/uPA Protein, Host: HEK293, Species Reactivity: Human, Purity: >92% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 45 kDa, Synonym: Urokinase,PLAU,ATF,UPA,URK,u-PA,BDPLT5,QPD, Storage: 4 deg C, Size: 50ug
Catalog Number: 103015-192
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-190

PLAU/uPA Protein 1mg

Description: PLAU/uPA Protein, Host: HEK293, Species Reactivity: Human, Purity: >92% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 45 kDa, Synonym: Urokinase,PLAU,ATF,UPA,URK,u-PA,BDPLT5,QPD, Storage: 4 deg C, Size: 1mg
Catalog Number: 103015-190
Supplier: ACROBIOSYSTEMS
Image Unavailable-103010-748

5(6) - FAM 1 g

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 1 g
Catalog Number: 103010-748
Supplier: Anaspec Inc
1,649 - 1,664 of 613,138