Print…

You Searched For: Molecular+Bioproducts+Inc.


613,126  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613126"

Rate These Search Results

Image Unavailable-103013-252

Recombinant [A/Shanghai/2/2013(H7N9)] Hemagglutinin (HA)

Description: Recombinant [A/Shanghai/2/2013(H7N9)] Hemagglutinin (HA), Host: HEK293 Cells, Species reactivity: Influenza, Purity: >95% by SDS-PAGE, Molecular Characterization: Fused with Fc fragment of human IgG1 at C-terminus, Synonym: H7N9, Size: 1mg
Catalog Number: 103013-252
Supplier: ACROBIOSYSTEMS
Image Unavailable-103009-020

Cyclo[ - RGDy - K(5 - FAM)] 1mg

Description: Cyclo[ - RGDy - K(5 - FAM)], Purity: Greater than or equal to 95% (HPLC), Molecular weight: 978, Sequence: Cyclo[ - RGDy - K(5 - FAM)], peptide is a 5-FAM-labeled cylic RGDyK peptide, serve as ligands for av-integrin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103009-020
Supplier: Anaspec Inc
Image Unavailable-103015-294

Recombinant Protein G 10mg

Description: Recombinant Protein G, Host: E.coli, Purity: >98% by SDS-PAGE, Molecular Characterization: fused with the polyhistidine tag at N-terminus and a single cysteine at C-terminus, Endotoxin: < 1.0 EU per ug, Synonym: RPG, Protein G, ProteinG, Storage: 4-8 deg C, Size: 10mg
Catalog Number: 103015-294
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-296

Recombinant Protein G 2mg

Description: Recombinant Protein G, Host: E.coli, Purity: >98% by SDS-PAGE, Molecular Characterization: fused with the polyhistidine tag at N-terminus and a single cysteine at C-terminus, Endotoxin: < 1.0 EU per ug, Synonym: RPG, Protein G, ProteinG, Storage: 4-8 deg C, Size: 2mg
Catalog Number: 103015-296
Supplier: ACROBIOSYSTEMS
Image Unavailable-103006-956

Forkhead derived peptide Woodtide 1 mg

Description: Forkhead derived peptide, Woodtide, substrate for the DYRK family of kinases in in-vitro analysis, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): KKISGRLSPIMTEQ-NH2, Molecular Weight: 1586.9, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-956
Supplier: Anaspec Inc
Image Unavailable-103013-076

Human FKBP12/FKBP1A Protein 1mg

Description: FKBP12/FKBP1A Protein, Host: E.coli, Species reactivity: Human, Purity: >95% as determined by SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at the C-terminus, MW of 12.8 kDa, Synonym: FKBP1A, FKBP1, Calstabin-1, FKBP12, Size: 1mg
Catalog Number: 103013-076
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-874

Human Lipocalin-2/NGAL Protein 100UG

Description: Lipocalin-2 / NGAL Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: polyhistidine tag at the C-terminus, MW of 22 kDa, Synonym: NGAL,LCN2,Lipocalin-2,24p3,MSFI, Storage: 4 deg C, Size: 100UG
Catalog Number: 103014-874
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-078

Human FKBP12/FKBP1A Protein 100ug

Description: FKBP12/FKBP1A Protein, Host: E.coli, Species reactivity: Human, Purity: >95% as determined by SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at the C-terminus, MW of 12.8 kDa, Synonym: FKBP1A, FKBP1, Calstabin-1, FKBP12, Size: 100ug
Catalog Number: 103013-078
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-538

Human BACE-1 Protein Tag Free 1mg

Description: BACE-1 Protein, Tag Free, Host: HEK293 cells, Species Reactivity: Human, Purity: >98% (SDS-PAGE), Molecular Characterization: Tag Free, with calculated MW of of 49 KDa, Synonyms: BACE1,ASP2,BACE,FLJ90568,HSPC104,KIAA1149,Memapsin-2, Storage: 4 deg C, Size: 1mg
Catalog Number: 103013-538
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-896

Mouse EpCAM/TROP1 Protein 100ug

Description: EpCAM/TROP1 Protein, Host: HEK293 Cells, Species: Mouse, Purity: >98% by SDS-PAGE, Molecular Characterization: His Tag is fused with a polyhistidine tag at the C-terminus, MW 18.4 kDa, Synonym: EPO, EP, MVCD2, Erythropoietin, Erythropoetin, Size: 100ug
Catalog Number: 103012-896
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-662

Biotinylated Human IL-6 epitope tag free

Description: Biotinylated IL-6, epitope tag free, ultra sensitivity (primary amine labeling), Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 20.8 kDa, Synonym: IL6,HGF, Storage: 4-8 deg C, Size: 25UG
Catalog Number: 103014-662
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-660

Biotinylated Human IL-6 epitope tag free

Description: Biotinylated IL-6, epitope tag free, ultra sensitivity (primary amine labeling), Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 20.8 kDa, Synonym: IL6,HGF, Storage: 4-8 deg C, Size: 200UG
Catalog Number: 103014-660
Supplier: ACROBIOSYSTEMS
Image Unavailable-102996-516

[Arg8]-Vasopressin (AVP)1 mg

Description: [Arg8]-Vasopressin (AVP), Purity: HPLC >/= 95%, Molecular Weight: 1084.3, Sequence: H-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH2, identified as an important regulator of fluid and electrolyte homeostasis through its anti-diuretic action on the kidney, Size: 1 mg
Catalog Number: 102996-516
Supplier: Anaspec Inc
Image Unavailable-103008-442

RYR2 (2460-2495) 1mg

Description: RYR2 (2460-2495), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4103.9, Sequence: GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP, amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2), controls calcium release, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-442
Supplier: Anaspec Inc
Image Unavailable-103013-040

Biotinylated Mouse FcRn/FCGRT & B2M Avitag*

Description: FcRn/FCGRT & B2M, Biotinylated, Host: HEK293 Cells, Species reactivity: Mouse, Purity: >95% SDS-PAGE, Molecular Characterization: carries an Avitag* at the C-terminus, followed by a polyhistidine tag, MW 34.7 kDa, Size: 25ug
Catalog Number: 103013-040
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-038

Biotinylated Mouse FcRn/FCGRT & B2M Avitag*

Description: FcRn/FCGRT & B2M, Biotinylated, Host: HEK293 Cells, Species reactivity: Mouse, Purity: >95% SDS-PAGE, Molecular Characterization: carries an Avitag* at the C-terminus, followed by a polyhistidine tag, MW 34.7 kDa, Size: 200ug
Catalog Number: 103013-038
Supplier: ACROBIOSYSTEMS
1,617 - 1,632 of 613,126