Print…

You Searched For: Molecular+Bioproducts+Inc.


613,122  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613122"

Rate These Search Results

Image Unavailable-10778-200

Recombinant Human Vitronectin

Description: Recombinant Human Vitronectin, 459 AA, single-chain, monomeric protein, which migrates at an apparent molecular weight of 75kDa, Animal Free, Source: HEK293 cells, Synonymns: VTN, Serum-spreading factor, V75, Purity: > 95% by SDS-PAGE gel and HPLC analyses, 500UG
Catalog Number: 10778-200
Supplier: PeproTech, Inc.
Image Unavailable-10778-198

Recombinant Human Vitronectin

Description: Recombinant Human Vitronectin, 459 AA, single-chain, monomeric protein, which migrates at an apparent molecular weight of 75kDa, Animal Free, Source: HEK293 cells, Synonymns: VTN, Serum-spreading factor, V75, Purity: > 95% by SDS-PAGE gel and HPLC analyses, 100UG
Catalog Number: 10778-198
Supplier: PeproTech, Inc.
Image Unavailable-10778-202

Recombinant Human Vitronectin

Description: Recombinant Human Vitronectin, 459 amino acid, single-chain, monomeric protein, which migrates at an apparent molecular weight of 75kDa, Animal Free, Source: HEK293 cells, Synonymns: VTN, Serum-spreading factor, V75, Purity: > 95% by SDS-PAGE gel and HPLC analyses, 1MG
Catalog Number: 10778-202
Supplier: PeproTech, Inc.
Image Unavailable-103015-192

PLAU/uPA Protein 50ug

Description: PLAU/uPA Protein, Host: HEK293, Species Reactivity: Human, Purity: >92% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 45 kDa, Synonym: Urokinase,PLAU,ATF,UPA,URK,u-PA,BDPLT5,QPD, Storage: 4 deg C, Size: 50ug
Catalog Number: 103015-192
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-190

PLAU/uPA Protein 1mg

Description: PLAU/uPA Protein, Host: HEK293, Species Reactivity: Human, Purity: >92% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 45 kDa, Synonym: Urokinase,PLAU,ATF,UPA,URK,u-PA,BDPLT5,QPD, Storage: 4 deg C, Size: 1mg
Catalog Number: 103015-190
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-012

Human Neprilysin/MME/CD10 Protein Tag Free

Description: Neprilysin / MME / CD10 Protein, Tag Free, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 80 kDa, Less than 1.0 EU per ug , Synonym: MME,CALLA,CD10,DKFZp686O16152,MGC126681, Storage: 4 deg C, Size: 50UG
Catalog Number: 103015-012
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-010

Human Neprilysin/MME/CD10 Protein Tag Free

Description: Neprilysin / MME / CD10 Protein, Tag Free, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 80 kDa, Less than 1.0 EU per ug , Synonym: MME,CALLA,CD10,DKFZp686O16152,MGC126681, Storage: 4 deg C, Size: 1MG
Catalog Number: 103015-010
Supplier: ACROBIOSYSTEMS
Image Unavailable-103007-532

O-linked GlcNAc transferase (OGT) Substrate 1 mg

Description: O-linked GlcNAc transferase (OGT) Substrate, Sequence: KKKYPGGSTPVSSANMM, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1783.1, Apperance: powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-532
Supplier: Anaspec Inc
Image Unavailable-103815-198

Flt-3 Protein, His Tag, Species Reactivity: Mouse, Host: HEK293, Purity: >90%, Molecular Weight: 59.9 kDa, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Synonym: Flt-3, Flk-2, STK-1, CD135, FLK2, FLT-3, Size: 100ug

Description: Flt-3 Protein, His Tag, Species Reactivity: Mouse, Host: HEK293, Purity: >90%, Molecular Weight: 59.9 kDa, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Synonym: Flt-3, Flk-2, STK-1, CD135, FLK2, FLT-3, Size: 100ug
Catalog Number: 103815-198
Supplier: ACROBIOSYSTEMS
Image Unavailable-103815-196

Flt-3 Protein, His Tag, Species Reactivity: Mouse, Host: HEK293, Purity: >90%, Molecular Weight: 59.9 kDa, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Synonym: Flt-3, Flk-2, STK-1, CD135, FLK2, FLT-3, Size: 1mg

Description: Flt-3 Protein, His Tag, Species Reactivity: Mouse, Host: HEK293, Purity: >90%, Molecular Weight: 59.9 kDa, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Synonym: Flt-3, Flk-2, STK-1, CD135, FLK2, FLT-3, Size: 1mg
Catalog Number: 103815-196
Supplier: ACROBIOSYSTEMS
Image Unavailable-103006-346

GRGDS amide (GRGDS - NH2) 5 mg

Description: GRGDS, amide (GRGDS - NH2), Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code: H - Gly - Arg - Gly - Asp - Ser - NH2, Molecular Weight: 489.5, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg
Catalog Number: 103006-346
Supplier: Anaspec Inc
Image Unavailable-BDH3054-201L

Bdh Phosphoric Acid 85% Acs H3Po4 201 L

Description: BDH* Phosphoric Acid, Purity: 85%, Grade: ACS, CAS Number: 7664-38-2, Molecular Formula: H3PO4, Molecular weight: 97.994 g/mol, Density: 1.69 kg/L, Size: 201L drum, 750lb
Catalog Number: BDH3054-201L
Supplier: BDH

Certificates


Image Unavailable-103011-118

Congo Red 1 g

Description: Congo Red, UltraPure Grade, Early diagnosis and classification of amyloid deposition, Molecular Weight: 696.7, Spectral Properties: Abs/Em = 497/NA nm, Solvent System: Water, CAS number: 573-58-0, Molecular formula: C32H22N6Na2O6S2, Physical State: Solid, Storage: -20 deg C, Size: 1 g
Catalog Number: 103011-118
Supplier: Anaspec Inc
Image Unavailable-103006-504

Beta-Amyloid (1-40)-Lys(Biotin)-NH2 Human 0.1 mg

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Molecular weight: 4683.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg
Catalog Number: 103006-504
Supplier: Anaspec Inc
Image Unavailable-102999-434

Beta - Amyloid (25 - 35). HCl 5 mg

Description: Beta - Amyloid (25 - 35). HCl, Human, mouse/rat, Sequence: GSNKGAIIGLM. HCl, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1060.3.36.5, Molecular Formula: C45H81N13O14S1Cl1, Apperance: Powder, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102999-434
Supplier: Anaspec Inc
Image Unavailable-102996-540

Endothelin 3 1 mg

Description: Endothelin 3, human, rat, Purity: HPLC >/= 95%, Molecular Weight: 2643.1, Sequence: CTCFTYKDKECVYYCHLDIIW, Appearance: Lyophilized white powder, is a member of a family of potent vasoconstrictors namely, Endothelin and Sarafotoxin, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-540
Supplier: Anaspec Inc
1,601 - 1,616 of 613,122