You Searched For: bra30


59,220  results were found

SearchResultCount:"59220"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (77437-904)
Supplier: Bioss
Description: MAP2 is the major microtubule associated protein of brain tissue. There are three forms of MAP2; two are similarily sized with apparent molecular weights of 280 kDa (MAP2a and MAP2b) and the third with a lower molecular weight of 70 kDa (MAP2c). In the newborn rat brain, MAP2b and MAP2c are present, while MAP2a is absent. Between postnatal days 10 and 20, MAP2a appears. At the same time, the level of MAP2c drops by 10-fold. This change happens during the period when dendrite growth is completed and when neurons have reached their mature morphology. MAP2 is degraded by a Cathepsin D-like protease in the brain of aged rats. There is some indication that MAP2 is expressed at higher levels in some types of neurons than in other types. MAP2 is known to promote microtubule assembly and to form side-arms on microtubules. It also interacts with neurofilaments, actin, and other elements of the cytoskeleton.


Catalog Number: (10782-100)
Supplier: Biosensis
Description: The amyloid beta peptide is derived from the cleavage of the Amyloid precursor protein (APP) and varies in length from 39 to 43 amino acids. However, the form(s) of amyloid-beta peptide (Aβ) associated with the pathology characteristic of Alzheimer’s disease (AD) remains unclear. In particular, the neurotoxicity of intraneuronal Aβ accumulation is an area of considerable research and controversy principally because antibodies thought to be specific for Aβ have been shown to actually detect intraneuronal APP and not Aβ exclusively. MOAB-2 (mouse IgG2b) is a pan-specific, high-titer antibody to Aβ residues 1-4 as demonstrated by biochemical and immunohistochemical analyses (IHC), and is highly specific just to amyloid beta peptide. MOAB-2 did not detect APP or APP-CTFs in cell culture media/lysates (HEK-APPSwe or HEK APPSwe/BACE1) or in brain homogenates from transgenic mice expressing 5 familial AD (FAD) mutation (5xFAD mice). Using IHC on 5xFAD brain tissue, MOAB-2 immunoreactivity co-localized with C-terminal antibodies specific for Aβ40 and Aβ42. MOAB-2 did not co-localize with either N- or C-terminal antibodies to APP. In addition, no MOAB-2-immunreactivity was observed in the brains of 5xFAD/BACE-/- mice, although significant amounts of APP were detected by N- and C-terminal antibodies to APP, as well as by 6E10. In both 5xFAD and 3xTg mouse brain tissue, MOAB-2 co-localized with cathepsin-D, a marker for acidic organelles, further evidence for intraneuronal Aβ, distinct from Aβ associated with the cell membrane. MOAB-2 demonstrated strong intraneuronal and extra-cellular immunoreactivity in 5xFAD and 3xTg mouse brain tissues.


Catalog Number: (89416-254)
Supplier: Prosci
Description: NPAS3 Antibody: Neuronal PAS domain protein 3 (NPAS3) is a brain-enriched basic helix-loop-helix PAS domain transcription factor and is broadly expressed in the developing neuroepithelium and has recently found to be disrupted by genetic translocation in a family affected with schizophrenia. It was recently shown to be involved in the regulation of FGF signaling in the dentate gyrus by controlling the expression of the FGF receptor subtype 1 and in turn neurogenesis emanating from this region. NPAS3-null mice were growth-retarded and displayed brain defects that included reduced size of the anterior hippocampus, hypoplasia of the corpus callosum, and enlargement of the ventricles, as well as several behavioral abnormalities. Furthermore, these NPAS3-null mice also exhibited disruptions in several neurosignaling pathways involving glutamate, dopamine, and serotonin. These results demonstrate the essential role played by NPAS3 during structural and functional brain development. At least three isoforms of NPAS3 are known to exist.


Catalog Number: (76119-386)
Supplier: Bioss
Description: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.


Catalog Number: (10396-692)
Supplier: Bioss
Description: Involved in the conversion of lanosterol to cholesterol.Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, and testis, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.


Catalog Number: (10338-358)
Supplier: Bioss
Description: Glypicans are glycosylphosphatidylinositol-anchored heparan sulphate proteoglycans, which are thought to modulate signalling by growth factors, including fibroblast growth factors and Wnts. Expression of glypican-4 has been reported in the mouse brain at embryonic day 7 and later stages.


Catalog Number: (10338-368)
Supplier: Bioss
Description: Glypicans are glycosylphosphatidylinositol-anchored heparan sulphate proteoglycans, which are thought to modulate signalling by growth factors, including fibroblast growth factors and Wnts. Expression of glypican-4 has been reported in the mouse brain at embryonic day 7 and later stages.


Catalog Number: (10434-994)
Supplier: Bioss
Description: The Ryanodine Receptor (RyR) is the channel responsible for calcium release from muscle cell Sarcoplasmic Reticulum (SR) and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains. The remainder of the protein, termed the "foot" region, is located in the cytoplasm between the transverse tubule and the SR. Mammalian RyR isoforms are the product of three different genes: RyR-1 is expressed predominantly in skeletal muscle and areas of the brain; RyR-2 is expressed predominantly in heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain; and RyR-3 is found in smooth muscle and the brain (striatum, thalamus and hippocampus). In non-mammalian vertebrates, the RyR isoforms are termed alpha, beta and cardiac which correlate loosely to the mammalian RyR-1, RyR-3 and RyR-2 isoforms respectively.


Catalog Number: (10434-998)
Supplier: Bioss
Description: The Ryanodine Receptor (RyR) is the channel responsible for calcium release from muscle cell Sarcoplasmic Reticulum (SR) and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains. The remainder of the protein, termed the "foot" region, is located in the cytoplasm between the transverse tubule and the SR. Mammalian RyR isoforms are the product of three different genes: RyR-1 is expressed predominantly in skeletal muscle and areas of the brain; RyR-2 is expressed predominantly in heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain; and RyR-3 is found in smooth muscle and the brain (striatum, thalamus and hippocampus). In non-mammalian vertebrates, the RyR isoforms are termed alpha, beta and cardiac which correlate loosely to the mammalian RyR-1, RyR-3 and RyR-2 isoforms respectively.


Catalog Number: (10269-044)
Supplier: Bioss
Description: Myo-inositol is involved in many important aspects of cellular regulation including membrane structure, signal transduction and osmoregulation. It is taken up into cells by the sodium/myo-inositol cotransporter (SMIT). SMIT activity maintains intracellular concentrations of myo-inositol; it is upregulated in response to hypertonic stress. The human SMIT protein is encoded by the SLC5A3 gene, which maps to chromosome 21q22.12. It is expressed in many human tissues, such as brain, kidney and placenta. Specifically, SMIT is abundantly expressed throughout the whole brain and spinal cord in fetal rat, but is downregulated in adult rat brain with the exception of the choroid plexus, where SMIT expression remains high. In kidney, SMIT localizes to the baso-lateral membranes of the thick ascending limb of Henle (TAL) and the inner medullary collecting duct (IMCD). Impaired SMIT activity is implicated in the pathogenesis of diabetes and Down syndrome.


Catalog Number: (10269-040)
Supplier: Bioss
Description: Myo-inositol is involved in many important aspects of cellular regulation including membrane structure, signal transduction and osmoregulation. It is taken up into cells by the sodium/myo-inositol cotransporter (SMIT). SMIT activity maintains intracellular concentrations of myo-inositol; it is upregulated in response to hypertonic stress. The human SMIT protein is encoded by the SLC5A3 gene, which maps to chromosome 21q22.12. It is expressed in many human tissues, such as brain, kidney and placenta. Specifically, SMIT is abundantly expressed throughout the whole brain and spinal cord in fetal rat, but is downregulated in adult rat brain with the exception of the choroid plexus, where SMIT expression remains high. In kidney, SMIT localizes to the baso-lateral membranes of the thick ascending limb of Henle (TAL) and the inner medullary collecting duct (IMCD). Impaired SMIT activity is implicated in the pathogenesis of diabetes and Down syndrome.


Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (10402-214)
Supplier: Bioss
Description: Involved in the conversion of lanosterol to cholesterol.Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, and testis, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.


Catalog Number: (10338-360)
Supplier: Bioss
Description: Glypicans are glycosylphosphatidylinositol-anchored heparan sulphate proteoglycans, which are thought to modulate signalling by growth factors, including fibroblast growth factors and Wnts. Expression of glypican-4 has been reported in the mouse brain at embryonic day 7 and later stages.


Catalog Number: (10402-210)
Supplier: Bioss
Description: Involved in the conversion of lanosterol to cholesterol.Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, and testis, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.


Catalog Number: (77440-574)
Supplier: Bioss
Description: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,969 - 1,984 of 59,220
no targeter for Bottom