You Searched For: GOLD STANDARD DIAGNOSTIC CORP.


59,965  results were found

SearchResultCount:"59965"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (470225-776)
Supplier: Ward's Science
Description: CAS Number: 13477-34-4
Formula Weight: 236.15
Formula: Ca(NO3)2·4H2O
Hazard Info: Flammable, Oxidizer, Explosive
Density (g/mL): 2.36
Boiling Point (°C): Decomposes
Freezing Point (°C): 45
Solubility: Water, Alcohol and Acetone
Synonyms: Calcium Nitrate Tetrahydrate, Nitric Acid Calcium(II) Salt
Shelf Life (months): 12
Storage: Yellow

SDS


Catalog Number: (470225-680)
Supplier: Ward's Science
Description: CAS Number: 1310-58-3
Formula Weight: 56.11
Formula: KOH
Hazard Info: Corrosive, Irritant, Toxic
Density (g/mL): 2.044
Boiling Point (°C): 1320
Freezing Point (°C): 361
Solubility: Water, Alcohol, and Glycerin
Synonyms: Caustic Potash, Potassium Hydrate
Shelf Life (months): 36
Storage: White

SDS


Catalog Number: (JT4018-4)
Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Free acid for liquid chromatography and molecular biology buffers. Lot analysis on label.

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Ideal for biotechnology, cell biology and molecular biology discovery, and biopharmaceutical production, J.T.Baker® brand denaturants offer high purity, low insolubles and heavy metals with minimal contaminants. Extensive experience in managing the risks associated with handling and mixing large volumes of corrosive materials has enabled us to provide custom solutions perfectly suited to your needs.
Supplier: Biotium
Description: A visible three-color protein marker for SDS-PAGE or western blotting, with 10 bands ranging from 10 to 180 kDa.

Supplier: Ward's Science
Description: CAS Number: 1303-96-4
Formula: Na2B4O7 10H2O
Density: 1.73 g/mL
Freezing Point: 62 °C
Solubility: Water and Glycerin
Synonyms: Sodium Tetraborate, Borax
Shelf Life: 12 Months

SDS

Catalog Number: (103007-174)
Supplier: Anaspec Inc
Description: Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (102999-764)
Supplier: Anaspec Inc
Description: This ANP (1-28) peptide hormone has been biotinylated at the N-terminus and can be used in conjugation experiments. ANP (1-28) constitutes the first 28 amino acids of the ANP synthesized in the heart of different vertebrates. It plays an important role in the regulation of blood pressure and natriuresis/diuresis. Residues Phe8, Arg14 and the C-terminal sequence of ANP are known to bind to human NPR-A (Natriuretic peptide receptor type A).
Sequence:Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
MW:3308.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (75832-840)
Supplier: IBI Scientific
Description: The IBI 1 kb DNA Ladder, containing 13 linear double-stranded DNA fragments is suitable for sizing double-stranded DNA from 250 to 10000 bp.

SDS


Catalog Number: (102971-216)
Supplier: Li-Cor
Description: WesternSure® chemiluminescent protein ladder is the only pre-stained, multi-colored protein ladder that provides film and digital detection.


Supplier: Thermo Scientific Chemicals
Description: Suitable for molecular biology applications

Catalog Number: (75832-464)
Supplier: IBI Scientific
Description: Ready-to-use 100 bp DNA ladder with excellent resolution of 12 different sized fragments at a great value.

SDS


Catalog Number: (470039-316)
Supplier: Edvotek
Description: Subunit molecular weights are determined by analysis using denaturing SDS vertical polyacrylamide electrophoresis (PAGE) and the included prestained, ready to load lyophilized proteins. Prestained proteins with unknown molecular weights are assigned molecular weights based on the relative mobility of prestained standard protein markers.


Catalog Number: (102971-126)
Supplier: Li-Cor
Description: These Pre-stained Protein Ladder provides multi-colored, pre-stained bands for visual inspection and two-color near-infrared detection


Catalog Number: (PAG4521)
Supplier: Promega Corporation
Description: Sixteen DNA fragments ranging from 50bp to 800bp in 50bp increments plus an 1,800bp "backbone" fragment.

Catalog Number: (80503-442)
Supplier: MilliporeSigma
Description: D-(+)-Sucrose, Molecular Biology Grade, Calbiochem®, Millipore®

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
513 - 528 of 59,965
no targeter for Bottom