You Searched For: STRAVER


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: CD23/FCER2 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <15pg/ml, Assay Range: 156-10000pg/ml, Immunogen: StandardExpression system : NSO, E50-P331 Alternative Names: CD23/Fc epsilon RII, BLAST-2 CD23, Size: For 5 plates, 96 wells each
Catalog Number: 76467-238
Supplier: Boster Biological Technology


Description: IL23 Receptor Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: E. Coli-derived mouse IL23 Receptor recombinant protein (Position: I25-D233), Synonym: IL-23 receptor, IL-23R, Il23r, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-094
Supplier: Boster Biological Technology


Description: ITGB1 Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human ITGB1 recombinant protein (Position: N527-D728). Human ITGB1 shares 91% and 88% amino acid (aa) sequences identity with mouse and rat ITGB1, respectively
Catalog Number: 10209-716
Supplier: Boster Biological Technology


Description: FITC conjugated rabbit rat IgG secondary antibody. Application: FCM, IHC-P, IHC-F, ICC. Pack Size: 0.5mg
Catalog Number: 10208-948
Supplier: Boster Biological Technology


Description: Flt-3ligand, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK, Synonyms: Fms-related tyrosine kinase 3 ligand, Flt3 ligand, Flt3L, SL cytokine, FLT3LG, Application: WB, Size: 100ug/vial
Catalog Number: 76174-032
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Amphiregulin(AR), Immunogen: E.coli, S101-K198, Assay range: 15.6pg/ml -1000pg/ml, Sensitivity: >10pg/ml, Sample: cell culture supernates, serum, plasma, saliva and human milk, 96-well plate precoated
Catalog Number: 10205-178
Supplier: Boster Biological Technology


Description: BCRP/ABCG2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human BCRP/ABCG2(154-168aa NHEKNERINRVIQEL).
Catalog Number: 10209-378
Supplier: Boster Biological Technology


Description: CXCL3 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species reactivity: Rat, Assay: 15.6pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-462
Supplier: Boster Biological Technology


Description: CXCL17 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <10pg/ml, Assay Range: 15.6pg/ml-1000pg/ml, Alternative Names: CXCL17/VCC-1, Chemokine (C-X-C Motif) Ligand 17, C-X-C Motif Chemokine 17, CXCL17, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-588
Supplier: Boster Biological Technology


Description: Collagen III Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-term of human Collagen III(1200-1221aa), Synonym: Collagen alpha-1(III) chain, Application: WB, Size: 100 ug/vial
Catalog Number: 76174-870
Supplier: Boster Biological Technology


Description: IRAK2 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, A synthetic peptide corresponding to a sequence at the C-terminus of human IRAK2, different from the related rat sequence by one amino acid, and from the related mouse sequence by three amino acids
Catalog Number: 10207-040
Supplier: Boster Biological Technology


Description: CES3 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <50pg/ml, Assay Range: 156pg/ml-10000pg/ml, Immunogen: /StandardExpression system for standard: NSO, sequence: Y19-L565, Alternative Names: Ces1d, Carboxylesterase 1D, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-632
Supplier: Boster Biological Technology


Description: BCRP/ABCG2 polyclonal antibody, Host: Rabbit, Species reactivity: Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse BCRP/ABCG2(152-167aa KNHEKNERINTIIKEL)
Catalog Number: 10209-380
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for mouse IL-17 Immunogen: E.coli, T22-A158 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 1 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10207-770
Supplier: Boster Biological Technology


Description: UPA Receptor/Plaur Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived rat uPA Receptor recombinant protein (Position: L25-R261), Alternative Names: uPAR, CD87 antigen, CD87, Monocyte activation antigen Mo3, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76464-056
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human IL-17RB, Immunogen: NSO, R18-K286, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-574
Supplier: Boster Biological Technology


49 - 64 of 5,847