You Searched For: Microbiology Stains

Description: This is a fluorescent plasminogen activator acrosine substrate, Abs/Em=380/500.
Sequence:Z-GGR-AFC
MW:633.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102996-450

Supplier: Anaspec Inc

Sale

Description: AMARA peptide is a minimal substrate for several members of the protein kinases family. It contains the phosphorylation site for AMP-activated Protein Kinase (AMPK). AMARA peptide may be employed in the applications to measure AMPK-related kinase activity.
Sequence:AMARAASAAALARRR
MW:1542.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-410

Supplier: Anaspec Inc

Sale

Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:KRREILSRRPSYR
MW:1717 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-190

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 amino acid residues 31 to 41 di-methylated at Lys-36.
Sequence:STGGV-K(Me2)-KPHRY
MW:1257.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-038

Supplier: Anaspec Inc

Sale

Description: This kit is optimized to detect anti-human MOG (1-125) IgG in mouse serum or cerebrospinal fluid. Wells are pre-coated with recombinant human MOG (1-125) protein and pre-blocked with BSA. The amount of anti-human MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Mouse anti-human MOG IgG standard is included. Ample materials and reagents are provided to perform 96 assays in a 96-well plate format.

Catalog Number: 102998-084

Supplier: Anaspec Inc

Sale

Description: This synthetic peptide is a biotinylated substrate for Syk kinase.
Sequence:Biotin-KEDPDYEWPSAK-NH2
MW:1689.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-864

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 555 amine is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are only slightly red-shifted compared to those of Cy3 dye, resulting in an optimal match to filters designed for Cy3 dyes.

Catalog Number: 103010-936

Supplier: Anaspec Inc

Sale

Description: Dansyl-X, SE, Synonym: Dansyl-X, NHS ester, amino-reactive building block used to prepare peptide conjugates and other bioconjugates, high efficient, Molecular Weight: 461.53, Spectral Properties: Abs/Em = 333/518 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 25 mg

Catalog Number: 103010-906

Supplier: Anaspec Inc

Sale

Description: This 11 mer peptide myelin oligodendrocyte glycoprotein ( pMOG) ( 44–54) represents the core binding epitope for MOG-specific CD8+ T cells. This is the minimal, functionally constant, length of the MOG (35–55) peptide that binds to CD8+ MOG-specific T cells and stimulates T cell proliferation in vitro.
Sequence: FSRVVHLYRNG
MW: 1347.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: 103006-880

Supplier: Anaspec Inc

Sale

Description: This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: 103006-512

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 488, SE is an excellent amine-reactive fluorescent labeling dye for generating protein conjugates. The spectrum of HiLyte™ Fluor488 is similar to fluorescein (FITC), resulting in an optimal match to filters designed for fluorescein.

Catalog Number: 103010-356

Supplier: Anaspec Inc

Sale

Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: 103003-048

Supplier: Anaspec Inc

Sale

Description: This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.
Sequence:rrrrrrrrGAELPPEFAAQLRKIGDKVYC
MW:3555.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-832

Supplier: Anaspec Inc

Sale

Description: [Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102999-364

Supplier: Anaspec Inc

Sale

Description: This product contains 0.5 mg of the 32 CEF peptides for a total of 16 mg in one vial. Used in the stimulation of IFNγ release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays.
% peak area by HPLC: ≥ 95
Storage condition: -20°C

Catalog Number: 103006-278

Supplier: Anaspec Inc

Sale

Description: This is a fluorescent (HiLyte™ Fluor 555)-labeled ß-Amyloid peptide, Abs/Em = 551/567 nm.

Catalog Number: 103003-180

Supplier: Anaspec Inc

Sale