You Searched For: L-Lysine+acetate+salt


55,896  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"55896"
Description: 99.999 B 50G
Catalog Number: AAA44433-18
Supplier: Thermo Scientific Chemicals

Description: 99.999 B 10G
Catalog Number: AAA44433-09
Supplier: Thermo Scientific Chemicals

Description: 99.999 250G
Catalog Number: AAA44433-30
Supplier: Thermo Scientific Chemicals

Catalog Number: IC10100350
Supplier: MP Biomedicals

SDS


Catalog Number: IC10100391
Supplier: MP Biomedicals

SDS


Description: (Deamino-Cys1, D-Arg8)-Vasopressin, 3-Mercaptopropionyl-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2 (Disulfide bond), Acetate salt, 5mg, Synonym: DDAVP, Desmopressin, C46H64N14O12S2, Cas number: 16679-58-6.
Catalog Number: H-7675.0005BA
Supplier: Bachem Americas


Description: Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3949.5, Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-246
Supplier: Anaspec Inc


Description: REacton*, 99.999% (REO)
Catalog Number: AA44056-18
Supplier: Thermo Scientific Chemicals

Description: REacton*, 99.999% (REO)
Catalog Number: AA44056-09
Supplier: Thermo Scientific Chemicals

Description: CAS #: 62667-64-5. Size: 5g.
Catalog Number: 100201-140
Supplier: Strem Chemicals Inc


Description: CAS #: 62667-64-5. Size: 1g.
Catalog Number: 100203-544
Supplier: Strem Chemicals Inc


Description: CAS #: 537-00-8. Size: 25g.
Catalog Number: 100210-028
Supplier: Strem Chemicals Inc


Description: CAS #: 537-00-8. Size: 100g.
Catalog Number: 100198-866
Supplier: Strem Chemicals Inc


Catalog Number: 470300-178
Supplier: Ward's Science

SDS


Description: 25g, 546-67-8, C2H4O2, 443.38
Catalog Number: TCL0021-25G
Supplier: TCI America

Catalog Number: 76723-132
Supplier: AMBEED, INC


1,521 - 1,536 of 55,896