You Searched For: L-Lysine+acetate+salt


55,893  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"55893"
Description: Co 24%.Crystals,WARNING: Inhalation of fumes or dust may be a cancer hazard,1kg,250g.
Catalog Number: AA12227-A1
Supplier: Thermo Scientific Chemicals

Description: Co 24%.Crystals,WARNING: Inhalation of fumes or dust may be a cancer hazard,1kg,250g.
Catalog Number: AA12227-30
Supplier: Thermo Scientific Chemicals

Description: 0.2% in 1% Acetic Acid
Catalog Number: 101410-896
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Description: Fluorescein Sodium, CAS number: 518-47-8, Molecular Formula: C20H10Na2O5, synonyms: Disodium 6-hydroxy-3-oxo-9-xanthene-o-benzoate, 9-o-Carboxyphenyl-6-hydroxy-3-isoxanthone, disodium salt, Soluble fluorescein, Sodium Fluorescein, size: 100 g
Catalog Number: 75872-508
Supplier: Spectrum Chemicals

Description: Fluorescein Sodium, CAS number: 518-47-8, Molecular Formula: C20H10Na2O5, synonyms: Disodium 6-hydroxy-3-oxo-9-xanthene-o-benzoate, 9-o-Carboxyphenyl-6-hydroxy-3-isoxanthone, disodium salt, Soluble fluorescein, Sodium Fluorescein, size: 25 g
Catalog Number: 75872-510
Supplier: Spectrum Chemicals

SDS


Description: Fluorescein Sodium, CAS number: 518-47-8, Molecular Formula: C20H10Na2O5, synonyms: Disodium 6-hydroxy-3-oxo-9-xanthene-o-benzoate, 9-o-Carboxyphenyl-6-hydroxy-3-isoxanthone, disodium salt, Soluble fluorescein, Sodium Fluorescein, size: 500 g
Catalog Number: 75872-512
Supplier: Spectrum Chemicals

SDS


Description: 99.999 B 50G
Catalog Number: AAA44433-18
Supplier: Thermo Scientific Chemicals

Description: 99.999 B 10G
Catalog Number: AAA44433-09
Supplier: Thermo Scientific Chemicals

Description: 99.999 250G
Catalog Number: AAA44433-30
Supplier: Thermo Scientific Chemicals

Catalog Number: 76728-588
Supplier: AMBEED, INC


Catalog Number: 76728-584
Supplier: AMBEED, INC


Catalog Number: 76728-586
Supplier: AMBEED, INC


Description: Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3949.5, Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-246
Supplier: Anaspec Inc


Description: Sodium bromodifluoroacetate 97
Catalog Number: 101796-510
Supplier: Matrix Scientific


Description: Bismuth(III) acetate, Purity: 99.999% trace metals basis, CAS Number: 22306-37-2, Molecular Formula: (CH3CO2)3Bi, Synonyms: Bismuth acetate, Size: 50G
Catalog Number: BT211860-50G
Supplier: BeanTown Chemical

SDS


Description: Bismuth(III) acetate, Purity: 99.999% trace metals basis, CAS Number: 22306-37-2, Molecular Formula: (CH3CO2)3Bi, Synonyms: Bismuth acetate, Size: 10G
Catalog Number: BT211860-10G
Supplier: BeanTown Chemical

SDS


1,505 - 1,520 of 55,893