Print…

You Searched For: L-Lysine+acetate+salt


55,724  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"55724"

Rate These Search Results

Image Unavailable-TCC2346-500G

, 6046-93-1, C4H6CuO4, 181.63

Description: , 6046-93-1, C4H6CuO4, 181.63
Catalog Number: TCC2346-500G
Supplier: TCI America

SDS Certificates


Image Unavailable-89167-800

Ponceau S Stain, 0.1%, 250 Ml

Description: Ponceau s stain is a rapid stain for the detection of proteins on cellulose acetate, pvdf, and nitrocellulose membranes.
Catalog Number: 89167-800
Supplier: G-Biosciences

SDS


Image Unavailable-89167-802

Ponceau S Stain, 0.1%, 500 Ml

Description: Ponceau s stain is a rapid stain for the detection of proteins on cellulose acetate, pvdf, and nitrocellulose membranes.
Catalog Number: 89167-802
Supplier: G-Biosciences

SDS


Product Image-101796-510

Sodium bromodifluoroacetate 97

Description: Sodium bromodifluoroacetate 97
Catalog Number: 101796-510
Supplier: Matrix Scientific
Image Unavailable-76803-108

Iron(II) acetate, Purity: 95%, CAS Number: 3094-87-9, Appearance: Form: Crystal - Powder / Colour: White - Yellow - Greyish yellow red, Storage: Inert atmosphere, Room Temperature, Size: 5G

Description: Iron(II) acetate, Purity: 95%, CAS Number: 3094-87-9, Appearance: Form: Crystal - Powder / Colour: White - Yellow - Greyish yellow red, Storage: Inert atmosphere, Room Temperature, Size: 5G
Catalog Number: 76803-108
Supplier: AMBEED, INC
Image Unavailable-76803-106

Iron(II) acetate, Purity: 95%, CAS Number: 3094-87-9, Appearance: Form: Crystal - Powder / Colour: White - Yellow - Greyish yellow red, Storage: Inert atmosphere, Room Temperature, Size: 25G

Description: Iron(II) acetate, Purity: 95%, CAS Number: 3094-87-9, Appearance: Form: Crystal - Powder / Colour: White - Yellow - Greyish yellow red, Storage: Inert atmosphere, Room Temperature, Size: 25G
Catalog Number: 76803-106
Supplier: AMBEED, INC
Image Unavailable-76803-102

Iron(II) acetate, Purity: 95%, CAS Number: 3094-87-9, Appearance: Form: Crystal - Powder / Colour: White - Yellow - Greyish yellow red, Storage: Inert atmosphere, Room Temperature, Size: 100G

Description: Iron(II) acetate, Purity: 95%, CAS Number: 3094-87-9, Appearance: Form: Crystal - Powder / Colour: White - Yellow - Greyish yellow red, Storage: Inert atmosphere, Room Temperature, Size: 100G
Catalog Number: 76803-102
Supplier: AMBEED, INC
Image Unavailable-AAA44433-18

CERM III ACET HYD

Description: 99.999 B 50G
Catalog Number: AAA44433-18
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-AAA44433-09

CERM III ACET HYD

Description: 99.999 B 10G
Catalog Number: AAA44433-09
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-AAA44433-30

CERM III ACET HYD

Description: 99.999 250G
Catalog Number: AAA44433-30
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-103008-246

Pramlintide Acetate [Pro25 28 29]-Amylin(1-37) 1mg

Description: Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3949.5, Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-246
Supplier: Anaspec Inc
Image Unavailable-77598-604

EDTA TETRASODIUM TETRAHYDRATE 500G

Catalog Number: 77598-604
Supplier: AMBEED, INC

New Product


Image Unavailable-AA44345-04

Cobalt (II) acetate

Description: 99.999%, (metals basis). 2g.
Catalog Number: AA44345-04
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-AA44345-09

Cobalt (II) acetate

Description: 99.999%, (metals basis). 10g.
Catalog Number: AA44345-09
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-AA44345-18

Cobalt(II) acetate tetrahydrate

Description: 99.999% (metals basis)
Catalog Number: AA44345-18
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-100210-028

Cerium (III) acetate hydrate (99.999%-Ce) (REO) PURATREM

Description: CAS #: 537-00-8. Size: 25g.
Catalog Number: 100210-028
Supplier: Strem Chemicals Inc
1,505 - 1,520 of 55,724