You Searched For: L-Lysine+acetate+salt


27,118  results were found

SearchResultCount:"27118"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: AMBEED, INC
Description: H-Lys(boc)-OtBu·HCl 95%

Catalog Number: (10782-516)
Supplier: Biosensis
Description: Lysine acetylation of histones and non-histone proteins plays an important part in many cellular processes such as chromatin and nuclear signaling, transcription, gene silencing, cell cycle progression, apoptosis, differentiation, DNA replication and repair.


Supplier: AMBEED, INC
Description: Fmoc-Lys(Ddiv)-OH 96%

Catalog Number: (103008-112)
Supplier: Anaspec Inc
Description: This synthetic peptide corresponds to amino acids 1-25 of human histone H3. It is trimethylated at lysine 4. The trimethylation of histone H3 at lysine 4 [H3K4(Me3)] shows cell state and lineage potential by differentiating genes that are expressed, poised for expression, or repressed. H3K4(Me3) also labels imprinting control regions.
Sequence:ART-K(Me3)-QTARKSTGGKAPRKQLATKAA-NH2
MW:2667.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (75790-580)
Supplier: Prosci
Description: SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease.


Supplier: Anaspec Inc
Description: Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
MW: 4867.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (76174-252)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Protein-lysine 6-oxidase(LOX) detection. Tested with WB, ELISA in Human;Mouse;Rat.


Catalog Number: (77172-202)
Supplier: ANTIBODIES.COM LLC
Description: Mouse monoclonal [5D9] antibody to Hexanoyl-Lysine adduct for WB, ICC/IF, FACS, Flow Cytometry, ELISA and IHC with samples derived from Species Independent.


Catalog Number: (10387-542)
Supplier: Bioss
Description: Modulation of the chromatin structure plays an important role in the regulation of transcription in eukaryotes. The nucleosome, made up of four core histone proteins (H2A, H2B, H3 and H4), is the primary building block of chromatin. The N-terminal tail of core histones undergoes different posttranslational modifications including acetylation, phosphorylation and methylation. These modifications occur in response to cell signal stimuli and have a direct effect on gene expression. In most species, the histone H2B is primarily acetylated at lysines 5, 12, 15 and 20. Histone H3 is primarily acetylated at lysines 9, 14, 18 and 23. Acetylation at lysine 9 appears to have a dominant role in histone deposition and chromatin assembly in some organisms. Phosphorylation at Ser10 of histone H3 is tightly correlated with chromosome condensation during both mitosis and meiosis.


Catalog Number: (10387-544)
Supplier: Bioss
Description: Modulation of the chromatin structure plays an important role in the regulation of transcription in eukaryotes. The nucleosome, made up of four core histone proteins (H2A, H2B, H3 and H4), is the primary building block of chromatin. The N-terminal tail of core histones undergoes different posttranslational modifications including acetylation, phosphorylation and methylation. These modifications occur in response to cell signal stimuli and have a direct effect on gene expression. In most species, the histone H2B is primarily acetylated at lysines 5, 12, 15 and 20. Histone H3 is primarily acetylated at lysines 9, 14, 18 and 23. Acetylation at lysine 9 appears to have a dominant role in histone deposition and chromatin assembly in some organisms. Phosphorylation at Ser10 of histone H3 is tightly correlated with chromosome condensation during both mitosis and meiosis.


Supplier: Bachem Americas
Description: Sequence: H-Lys(Boc)-OMe · HCl

Catalog Number: (BD354688)
Supplier: Corning
Description: Corning® BioCoat™ 8-well culture slide with a uniform application of PDL/Laminin. Glass slide with polystyrene vessel, lid, and safety removal tool. 4/pack, 12/case. Corning BioCoat products are an ideal solution for enhanced cell attachment and growth of a variety of primary cells and transformed cells in serum-free or serum-containing cultures. Corning offers custom coating capabilities.

Supplier: Thermo Fisher Scientific
Description: These nonsterile polystyrene plates feature either Collagen I or Poly-D-Lysine coated surfaces for cell based assays

Catalog Number: (103255-502)
Supplier: RevMAb Biosciences
Description: This antibody reacts to Histone H3 acetylated at Lysine 23 (K23ac). No cross reactivity with other acetylated Lysines in histone H3.


Catalog Number: (103255-496)
Supplier: RevMAb Biosciences
Description: This antibody reacts to Histone H4 acetylated at Lysine 16 (K16ac). No cross reactivity with other acetylated Lysines in Histone H4.


Supplier: Corning
Description: For some applications, the use of a combination of ECM proteins, such as Laminin (LM) and Fibronectin (HFN) or LM and attachment factors such as Poly-D-Lysine (PDL) or Poly-L-Orinthine (PLO) has been shown superior to the use of either alone. Corning BioCoat PDL/LM and PLO/LM Cultureware is suitable for culturing many different types of Peripheral Nervous System (PNS) and Central Nervous System (CNS) networks and is useful for promoting neural cell attachment and differentiation. Corning BioCoat LM/HFN Cultureware provides an in vitro environment that promotes cell attachment and extensive process formation.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,233 - 1,248 of 27,118
no targeter for Bottom