You Searched For: viral+rna


55,724  results were found

SearchResultCount:"55724"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (EM8.22286.5000)
Supplier: MilliporeSigma

Catalog Number: (BDH9254-500G)
Supplier: VWR International

Catalog Number: (BDH7621-4)
Supplier: VWR International
Description: Suitable as a titrant. Made with deionized water.

Catalog Number: (BDH7621-1)
Supplier: VWR International
Description: Suitable as a titrant. Made with deionized water.

Catalog Number: (BDH9204-500G)
Supplier: VWR International

Catalog Number: (BDH9204-2.5KG)
Supplier: VWR International

Catalog Number: (BDH9204-12KG)
Supplier: VWR International

Catalog Number: (BDH7314-10)
Supplier: VWR International

Catalog Number: (BDH7314-1)
Supplier: VWR International
Description: Suitable as a titrant. Made with deionized water.

Catalog Number: (BDH7314-4)
Supplier: VWR International
Description: Suitable as a titrant. Made with deionized water.

Catalog Number: (PAV5111)
Supplier: Promega Corporation
Description: Store lyophilized or in Resuspension Buffer (50mM acetic acid) at -20[degree]C. Sequencing Grade Modified Trypsin purified from porcine specifically hydrolyzes peptide bonds at the carboxylic sides of lysine and arginine residues.

Catalog Number: (BDH9278-500G)
Supplier: VWR International

Catalog Number: (BDH9278-2.5KG)
Supplier: VWR International

Catalog Number: (BDH7590-2)
Supplier: VWR International
Description: Made with deionized water.

Catalog Number: (BDH4616-500G)
Supplier: VWR International
Description: EDTA, DISODIUM SALT, PWD, RGT, ACS Reagent, CAS Number: 6381-92-6, Assay 99.0-101.0 %, pH (25 deg C; 5 %) 4.0-6.0, Heavy metals (as Pb) Max. 0.005 %, Insoluble matter Max. 0.005 %, Nitrilotriacetic acid Max. 0.1 %, Fe (Iron) Max. 0.01 %, Size: 500g

Catalog Number: (103007-216)
Supplier: Anaspec Inc
Description: [Lys22] - beta - Amyloid (1 - 42), Italian Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, lysine substituted for glutamic acid at position 22, Molecular Weight: 4513.2, Storage: -20 C, Size: 0.5 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
225 - 240 of 55,724
no targeter for Bottom