Print…

You Searched For: L-Lysine+acetate+salt


55,872  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"55872"

Rate These Search Results

Product Image-100488-872

GRID SLIDES, POLY-L-LYSINE, 72/PK

Description: 3x1" slides without hydrophobic coating, with an indexed grid on reverse side of frosted end, ink is resistant to stains and common laboratory solvents, each square grid fills one low-powered-field (approximately 100X m
Catalog Number: 100488-872
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Product Image-100490-302

GRID SLIDES, POLY-L-LYSINE, 144/PK

Description: 3x1" slides without hydrophobic coating, with an indexed grid on reverse side of frosted end, ink is resistant to stains and common laboratory solvents, each square grid fills one low-powered-field (approximately 100X
Catalog Number: 100490-302
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Image Unavailable-102996-406

Glucagon-Like Peptide 1 0.5 mg

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-406
Supplier: Anaspec Inc
Image Unavailable-102996-408

Glucagon-Like Peptide 1 1 mg

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-408
Supplier: Anaspec Inc
Image Unavailable-10348-006

HDAC10 Antibody

Description: HDAC10 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: HD 10; HD10; HDAC 10, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10348-006
Supplier: Bioss
Image Unavailable-89329-908

Mouse Monoclonal antibody to Acetylated Lysine

Description: Clone: 7F8 Purity: Protein G purified Species Reactivity: Bird, Cow Tested Applications: ELISA, IHC, WB Pkg Size: 100 ug
Catalog Number: 89329-908
Supplier: Genetex
Product Image-76009-500

PRSS3 PAB 400ul

Description: PRSS3 Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Isotype: Ig, Immunogen: Immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human PRSS3, Synonyms: Trypsin-3, Brain trypsinogen, Uses: IHC-P, WB, Size: 400ul
Catalog Number: 76009-500
Supplier: Prosci
Product Image-76012-318

GCDH Polyclonal Antibody 400ul

Description: GCDH Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: Igg, Immunogen: generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-365 amino acids from the C-terminal region of human GCDH. Synonyms: GCD, GCDH, Size: 400ul
Catalog Number: 76012-318
Supplier: Prosci
Product Image-10813-872

HDAC6 (phospho Ser22) Polyclonal Antibody 0.1mg

Description: HDAC6 (phospho Ser22), Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Immunogen: raised against a peptide sequence around phosphorylation site of serine 22 (P-Q-S (p)-P-P) derived from Human HDAC6, Size: 0.1 mg
Catalog Number: 10813-872
Supplier: Prosci
Product Image-76175-642

Microplate 1536 Well 8ul

Description: Microplate, 1536 Well, Color: Black, Clear Bottom, Low Base, COC, Poly-D-Lysine Coated, Without Lid, with Bar codes, Smooth Top, Excellent signal dynamic range due to low background fluorescence and enhanced signal intensity, Superior flatness, Working Volume: Upto 8ul
Catalog Number: 76175-642
Supplier: Corning

Certificates


Product Image-10105-304

HMG20A Antibody

Description: Polyclonal, Host species: Rabbit; Species reactivity: Human, Mouse, Rat, Dog; Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human HMG20A; Purified by protein A chromatography method; Applications: Elisa, Western Blotting
Catalog Number: 10105-304
Supplier: Prosci
Image Unavailable-103008-006

[Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin) H3K27(Me2) 1 mg

Description: [Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me2), biotin-labeled, Sequence: ATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, residues 21 to 44 di-methylated at Lys-27, Molecular Weight: 2945.5, Size: 1 mg
Catalog Number: 103008-006
Supplier: Anaspec Inc
Image Unavailable-75790-920

GCDH Recombinant Protein 50ug

Description: GCDH Recombinant Protein, Species: Human, Source: E. Coli, Sequence: Arg45-Lys438, Fusion tag: N-6 His tag, Purity: Greater than 95% by SDS-PAGE, Synonyms: Glutaryl-CoA Dehydrogenase Mitochondrial, GCD, GCDH, Applications: used for biological assays, Size: 50ug
Catalog Number: 75790-920
Supplier: Prosci
Product Image-10347-968

HDAC8 Antibody

Description: HDAC8 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: HD 8; HD8; HDAC 8; HDACL 1, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10347-968
Supplier: Bioss
Product Image-10347-716

HDAC4 Antibody

Description: HDAC4 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: HD 4; HD4; HDAC 4; HDAC A; HDACA, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10347-716
Supplier: Bioss
Image Unavailable-89322-980

Rabbit Polyclonal antibody to SETD7 (SET domain containing (lysine methyltransferase) 7)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89322-980
Supplier: Genetex
3,233 - 3,248 of 55,872