Print…

You Searched For: Benzyl-N-(3-ethyloxetan-3-yl)carbamate


55,893  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"55893"

Rate These Search Results

Image Unavailable-102996-406

Glucagon-Like Peptide 1 0.5 mg

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-406
Supplier: Anaspec Inc
Image Unavailable-10244-852

PRSS2 Antibody

Description: PRSS2 Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: EC 3.4.21.4; MGC111183; MGC120174; Protease serine 2 preproprotein, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10244-852
Supplier: Bioss
Image Unavailable-10795-122

Antibody

Description: Jarid1C, Monoclonal Antibody, Clone: 2E4-E1-G8, Host: Mouse, Isotype: IgG2a, Species reactivity: Human, Immunogen: Purified recombinant human Jarid1C (C-terminus) protein fragments expressed in E.coli, Synonymns: lysine (K)-specific demethylase 5C, Application: ICC/IF, WB, Size: 100UG
Catalog Number: 10795-122
Supplier: Genetex
Image Unavailable-10348-006

HDAC10 Antibody

Description: HDAC10 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: HD 10; HD10; HDAC 10, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10348-006
Supplier: Bioss
Image Unavailable-103007-984

[Lys(Ac)9]-Histone H3 (1-21)-GGK(Biotin) 0.25 mg

Description: [Lys(Ac)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Ac), Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC greater than or equal to 95%, Histone H3 amino acid residues 1 to 21 acetylated at Lys-9, Molecular Weight: 2765.3, Size: 0.25 mg
Catalog Number: 103007-984
Supplier: Anaspec Inc
Image Unavailable-89329-908

Mouse Monoclonal antibody to Acetylated Lysine

Description: Clone: 7F8 Purity: Protein G purified Species Reactivity: Bird, Cow Tested Applications: ELISA, IHC, WB Pkg Size: 100 ug
Catalog Number: 89329-908
Supplier: Genetex
Image Unavailable-103008-166

[Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin) H3K36(Me2) 0.25mg

Description: [Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2945.5, Sequence: ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 0.25mg
Catalog Number: 103008-166
Supplier: Anaspec Inc
Image Unavailable-103006-540

[Lys(Ac)5] - Histone H4 (1 - 21) - GGK(Biotin) H4K5(Ac) biotin - labeled 1mg

Description: [Lys(Ac)5] - Histone H4 (1-21) - GGK(Biotin), H4K5(Ac), biotin - labeled, Purity: HPLC >/= 95%, Sequence (One-Letter Code): Ac-SGRG-K(Ac)-GGKGLGKGGAKRHRKVGG-K(Biotin), Molecular weight: 2644.1, Storage: -20deg C, Size: 1mg
Catalog Number: 103006-540
Supplier: Anaspec Inc
Image Unavailable-103008-168

[Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin) H3K36(Me2) 1mg

Description: [Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2945.5, Sequence: ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-168
Supplier: Anaspec Inc
Image Unavailable-10347-984

HDAC8 Antibody

Description: HDAC8 Polyclonal Antibody, Host: Rabbit, Cy5.5 Conjugated, Emmission: 675nm/694nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: HD 8; HD8; HDAC 8; HDACL 1, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10347-984
Supplier: Bioss
Image Unavailable-103008-226

[Lys(Me1)79]-Histone H3 (69-89)-K(Biotin) H3K79(Me1) 0.25mg

Description: [Lys(Me1)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2848.3, Sequence: RLVREIAQDF-K(Me1)-TDLRFQSSAV-K(Biotin), Label: Biotin, Histone H3, Storage: -20 degree C, Size: 0.25mg
Catalog Number: 103008-226
Supplier: Anaspec Inc
Image Unavailable-103006-536

[Lys(Ac)8] - Histone H4 (1 - 21) - GGK(Biotin) H4K8(Ac) biotin - labeled 1mg

Description: [Lys(Ac)8] - Histone H4 (1-21) - GGK(Biotin), H4K8(Ac), biotin - labeled, Purity: HPLC >/= 95%, Sequence (One-Letter Code): Ac-SGRGKGG-K(Ac)-GLGKGGAKRHRKV-GGK(Biotin), Molecular weight: 2644.1, Storage: -20deg C, Size: 1mg
Catalog Number: 103006-536
Supplier: Anaspec Inc
Image Unavailable-103007-980

[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin) H3K9(Me3) 0.25 mg

Description: [Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled, Sequence: ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21 tri-methylated at Lys-9, Molecular Weight: 2765.2, Size: 0.25 mg
Catalog Number: 103007-980
Supplier: Anaspec Inc
Image Unavailable-103007-982

[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin) H3K9(Me3) 1 mg

Description: [Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled, Sequence: ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21 tri-methylated at Lys-9, Molecular Weight: 2765.2, Size: 1 mg
Catalog Number: 103007-982
Supplier: Anaspec Inc
Product Image-PI20233

TPCK Trypsin (2,000 BAEE Units)

Description: Group: TPCK Trypsin and Immobilized TPCK Trypsin. Cleave specifically at the COOH side of arginine and lysine. Immobilized TPCK Trypsin makes it easier to eliminate trypsin contamination in tryptic digests
Catalog Number: PI20233
Supplier: Invitrogen

Certificates


Image Unavailable-10096-592

Anti-UQCRQ

Description: Anti-UQCRQ Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 1-82 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10096-592
Supplier: Proteintech
1 - 16 of 55,893