Description: Aquaporin-2 (254-267), pSER261, human, plays a key role in vasopressin signaling in the renal-collecting duct, Purity: HPLC >/= 95%, Sequence (One-Letter Code): RQSVELH-pS-PQSLPR, MW: 1713.8, Appearance: off white solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-576

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Neprilysin Activity Assay Kit *Fluorimetric*, Components: 5-FAM/QXLTM-520 Neprilysin substrate 1 mM, 50 uL, 5-FAM 1 mM, 15 uL, Recombinant human neprilysin 10 ug/mL, 100 uL, 2X Assay Buffer 30 mL, Inhibitor 0.1 mM, 15 uL

Catalog Number: 103010-662

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Molecular weight: 4683.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103006-504

Supplier: Anaspec Inc

Sale

Description: 6-HEX, SE, Synonym: 6-carboxy-2',4,4',5',7,7'-hexachlorofluorescein, succinimidyl ester; 6-HEX, NHS ester, amino-reactive fluorescent probe widely used in nucleic acid sequencing, MW: 680.06, Spectral Properties: Abs/Em = 533/550 nm, Solvent System: DMF or DMSO, Size: 5 mg

Catalog Number: 103010-794

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 acid, SE, amine-reactive fluorescent labeling dye, Synonym: HiLyte* Fluor 488 acid, NHS ester, Molecular Weight: 698.6, Spectral Properties: Abs/Em = 502/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103010-874

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid Peptide (1-40), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4233.8, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized off-white powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-718

Supplier: Anaspec Inc

Sale

Description: Recombinant human MOG (1 - 125), Source: E.Coli, Purity: Greater than 95% as determined by SDS-PAGE, Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL) assay, Storage: 2-4 degree Celcius, Size: 500ug

Catalog Number: 102998-100

Supplier: Anaspec Inc

Sale

Description: [Met]-beta-Amyloid (1-42), human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 5057.8, Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Label: 5-TAMRA, b-amyloid (1-42) peptide with N-term methionine, Storage: -20 degree C, Size: 0.1mg

Catalog Number: 103008-216

Supplier: Anaspec Inc

Sale

Description: Human Glucagon-Like Peptide 1, GLP-1 (7-36), amide

Catalog Number: 102996-228

Supplier: Anaspec Inc

Sale

Description: Crosstide [GRPRTSSFAEG], Purity: HPLC >/- 95%, Molecular Weight: 1522.6, Sequence: 5-FAM-Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly-OH, label: 5-FAM, It displays similar specificities towards PKBA, PKBB and PKBY isoforms, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-134

Supplier: Anaspec Inc

Sale

Description: [Leu27] - Melan - A, MART 1 (26 - 35) (ELAGIGILTV), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Glu - Leu - Ala - Gly - Ile - Gly - Ile - Leu - Thr - Val - OH, MW: 985.8, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-246

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (1-34)

Catalog Number: 103006-992

Supplier: Anaspec Inc

Sale

Description: DiBAC4(3), Synonym: Bis-(1,3-dibutylbarbituric acid)trimethine oxonol, UltraPure Grade, Sensitive 488 nm-excitable membrane potential probe, MW: 516.6, Spectral Properties: Abs/Em = 493/516 nm, Solvent System: DMSO, Appearance: Red solid, Purity: > 95 % (HPLC), Size: 25 mg

Catalog Number: 103011-228

Supplier: Anaspec Inc

Sale

Description: Recombinant Rat MOG Protein, Source: E. Coli, Purity: Greater than 95% (SDS-PAGE), Endotoxin: Less than 0.1EU/1ug of the protein, Application: EAE induction and in vitro studies such as T cell proliferation, cytokine induction, WB, ELISA, Storage: Freezer, Size: 1000ug

Catalog Number: 103001-238

Supplier: Anaspec Inc

Sale

Description: Protegrine-1 (PG-1), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2155.7, Sequence: RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge: 6-15 and 8-13), Protegrin-1 (PG-1) with a modified C-terminal amide, Storage: -20 degree C, Size: 0.5mg

Catalog Number: 103008-470

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 38), mouse, rat, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4035.5, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-364

Supplier: Anaspec Inc

Sale