Print…

You Searched For: Cell+Culture+Solutions


259,723  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"259723"

Rate These Search Results

Product Image-76030-814

Zeta Plus* Encapsulated System Filter Capsule EXT 90SP05A

Description: Zeta Plus* Encapsulated System Filter Capsule, EXT, with SP Series Media, Dual Layer, Standard, No: of cells: 1, Gasket material: Silicone, Grade: 90SP05A, for bioprocessing-upstream cell culture clarification/downstream impurity removal
Catalog Number: 76030-814
Supplier: SOLVENTUM PURIFICATION INC
Product Image-76030-850

Zeta Plus* Encapsulated System Filter Capsule EXT 60SP03A

Description: Zeta Plus* Encapsulated System Filter Capsule, EXT, with SP Series Media, Dual Layer, Alkaline resistant, No: of cells: 1, Gasket material: Silicone, Grade: 60SP03A, for upstream cell culture clarification or downstream impurity removal
Catalog Number: 76030-850
Supplier: SOLVENTUM PURIFICATION INC
Product Image-76030-826

Zeta Plus* Encapsulated System Filter Capsule EXT 10SP02A

Description: Zeta Plus* Encapsulated System Filter Capsule, EXT, with SP Series Media, Dual Layer, Standard, No: of cells: 7, Gasket material: Silicone, Grade: 10SP02A, for bioprocessing-upstream cell culture clarification/downstream impurity removal
Catalog Number: 76030-826
Supplier: SOLVENTUM PURIFICATION INC
Image Unavailable-76177-842

D-Biotin Cell Culture Reagent >/=97.5% 500mg

Description: D-Biotin Cell Culture Reagent >/= 97.5%, CAS No: 58-85-5, Molecular Formula: C10H16N2O3S, Molecular Weight: 244.3, Synonyms: Vitamin H, Coenzyme R, D-(+)-Biotin, Hexahydro-2-oxo-1H-thieno[3,4-d]imidazole-4-pentanoic acid, Bios II, Vitamin B7, Size: 500mg
Catalog Number: 76177-842
Supplier: MP Biomedicals
Image Unavailable-76177-768

D-Biotin Cell Culture Reagent >/= 97.5% 1g

Description: D-Biotin Cell Culture Reagent >/= 97.5%, CAS No: 58-85-5, Molecular Formula: C10H16N2O3S, Molecular Weight: 244.3, Synonyms: Vitamin H, Coenzyme R, D-(+)-Biotin, Hexahydro-2-oxo-1H-thieno[3,4-d]imidazole-4-pentanoic acid, Bios II, Vitamin B7, Size: 1g
Catalog Number: 76177-768
Supplier: MP Biomedicals
Image Unavailable-IC10225980

MENADIONE (VITAMIN K 100.00 GM

Catalog Number: IC10225980
Supplier: MP Biomedicals

SDS


Image Unavailable-IC10225925

MENADIONE (VITAMIN K 25.00 GM

Catalog Number: IC10225925
Supplier: MP Biomedicals

SDS Certificates


Image Unavailable-103007-212

[Gln22, Asn23] - beta - Amyloid (1 - 40) 0.5 mg

Description: [Gln22, Asn23] - beta - Amyloid (1 - 40), E22Q/D23N Dutch/Iowa double mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-212
Supplier: Anaspec Inc
Product Image-76045-160

Bovine albumin Fraction V Protease Free 1kg

Description: Bovine albumin Fraction V, From Bovine blood, Protease Free, Purity: 99%, Synonyms: BSA, Bovine albumin, Application: IA, Mammalian Cell Culture, pH: 7.0 (10% aqueous solution), 6.9 (saline), Protein or Enzyme Type: Albumins, Store at 2-8 C, Size: 1kg
Catalog Number: 76045-160
Supplier: MP Biomedicals
Image Unavailable-IC0219476301

Uridine 1G

Description: Uridine, cell culture reagent, is a nucleoside, contains an uracil attached to a ribose ring, Purity: approx 99%, CAS Number: 58-96-8, MF: C9H12N2O6, Molecular Weight: 244.2, Form: Powder, color: White, Synonyms: 1-B-D-Ribofuranosyluracil, Uracil-1-B-D-ribofuranoside, size: 1G
Catalog Number: IC0219476301
Supplier: MP Biomedicals

Certificates


Image Unavailable-IC0219476350

Uridine 50G

Description: Uridine, cell culture reagent, is a nucleoside, contains an uracil attached to a ribose ring, Purity: approx 99%, CAS Number: 58-96-8, MF: C9H12N2O6, Molecular Weight: 244.2, Form: Powder, color: White, Synonyms: 1-B-D-Ribofuranosyluracil, Uracil-1-B-D-ribofuranoside, size: 50G
Catalog Number: IC0219476350
Supplier: MP Biomedicals

Certificates


Product Image-82021-606

Apoptosis Inducers, Etoposide

Description: Ready-to-use high quality apoptosis inducers allow users an easy tool for induction of apoptosis in cultured cells. These stabilized reagent solutions have a long storage life and are easy to use. 100 mM, 0.05 mL.
Catalog Number: 82021-606
Supplier: G-Biosciences
Image Unavailable-76177-682

3-(4,5-Dimethyl-2-thiazolyl-2)-2,5-diphenyl-tetrazolium bromide 100mg

Description: 3-(4,5-Dimethyl-2-thiazolyl-2)-2,5-diphenyl-tetrazolium bromide, Purity: Approx 98%, Grade: Cell Culture Reagent, CAS: 298-93-1, MF: C18H16BrN5S, MW: 414.3, Synonyms: MTT, Methylthiazolyldiphenyl-tetrazolium bromide, Size: 100mg
Catalog Number: 76177-682
Supplier: MP Biomedicals
Image Unavailable-76177-684

3-(4,5-Dimethyl-2-thiazolyl-2)-2,5-diphenyl-tetrazolium bromide 500mg

Description: 3-(4,5-Dimethyl-2-thiazolyl-2)-2,5-diphenyl-tetrazolium bromide, Purity: Approx 98%, Grade: Cell Culture Reagent, CAS: 298-93-1, MF: C18H16BrN5S, MW: 414.3, Synonyms: MTT, Methylthiazolyldiphenyl-tetrazolium bromide, Size: 500mg
Catalog Number: 76177-684
Supplier: MP Biomedicals
Image Unavailable-76177-686

3-(4,5-Dimethyl-2-thiazolyl-2)-2,5-diphenyl-tetrazolium bromide 1g

Description: 3-(4,5-Dimethyl-2-thiazolyl-2)-2,5-diphenyl-tetrazolium bromide, Purity: Approx 98%, Grade: Cell Culture Reagent, CAS: 298-93-1, MF: C18H16BrN5S, MW: 414.3, Synonyms: MTT, Methylthiazolyldiphenyl-tetrazolium bromide, Size: 1g
Catalog Number: 76177-686
Supplier: MP Biomedicals
Image Unavailable-700008-796

HEPES BIOLOGICAL BUFFER

Description: N-(2-Hydroxyethyl)piperazine-NÆ-2-ethanesulfonic Acid. CAS: 7365-45-9. Size: 100 g.
Catalog Number: 700008-796
Supplier: Spectrum Chemicals

Certificates


1,009 - 1,024 of 259,723