You Searched For: Ansell+Isolator+Gloves

Catalog Number: (89350-864)

Supplier: Genetex

Description: RAS proteins are signal-transducing, guanine nucleotide-binding proteins that appear to function as a branchpoint in signal transduction. RAS coordinates the activity of multiple signalling pathways, regulating diverse cellular functions including cell growth, differentiation and apoptosis. The human RAS gene family consists of three identified members which encode proteins of 21 kDa. Human cH RAS and cK RAS are the cellular homologs of vH- and vK RAS originally isolated from Harvey and Kirsten strains of rat sarcoma viruses. The third family member is designated cN RAS. Normal cellular ras genes are referred to as protooncogenes and have the potential for activation to oncogenes by mutations occurring in codons 12, 13 and 61. Such mutated, activated and transforming ras genes have been identified and isolated from human tumors and cultured tumor cells. Although the expression patterns of ras proto-oncogene proteins in normal human tissues are known, similar information for activated ras oncogene encoded p21s and their relevance to human disease diagnosis and prognosis remains to be determined.

Sale

Catalog Number: (100242-994)

Supplier: Southern Biotechnology

Description: Protein tyrosine residues are phosphorylated as a result of intracellular protein kinase activation (e.g., via growth factors) during normal growth and development and in oncogenesis. The most abundant population of target proteins for tyrosine phosphorylation is cell surface glycoproteins. Antibodies to phosphotyrosine enable the detection, isolation, and characterization of proteins containing phosphotyrosine. The monoclonal antibody PY20 prevents internalization of activated receptors (e.g., EGFR) when microinjected into cells. The affinity of PY20 for phosphotyrosine is approximately 10-6 to 10-7 M. PY20 binding to phosphorylated tyrosines can be inhibited by free phosphotyrosine and phenylphosphate but not by phosphoserine, phosphothreonine, or free phosphate.

Sale

Catalog Number: (102649-318)

Supplier: Jackson Immunoresearch Lab

Description: Whole IgG antibodies are isolated as intact molecules from antisera by immunoaffinity chromatography. They have an Fc portion and two antigen binding Fab portions joined together by disulfide bonds and therefore they are divalent. The average molecular weight is reported to be about 160 kDa. The whole IgG form of antibodies is suitable for the majority of immunodetection procedures and is the most cost effective. Based on immunoelectrophoresis and/or ELISA, the antibody reacts with whole molecule goat IgG. It also reacts with the light chains of other goat immunoglobulins. No antibody was detected against non-immunoglobulin serum proteins. The antibody may cross-react with immunoglobulins from other species.

Sale

Catalog Number: (102644-060)

Supplier: Jackson Immunoresearch Lab

Description: Whole IgG antibodies are isolated as intact molecules from antisera by immunoaffinity chromatography. They have an Fc portion and two antigen binding Fab portions joined together by disulfide bonds and therefore they are divalent. The average molecular weight is reported to be about 160 kDa. The whole IgG form of antibodies is suitable for the majority of immunodetection procedures and is the most cost effective. Based on immunoelectrophoresis and/or ELISA, the antibody reacts with the Fc portion of bovine IgG heavy chain but not with the Fab portion of bovine immunoglobulins. No antibody was detected against non-immunoglobulin serum proteins. The antibody may cross-react with immunoglobulins from other species.

Sale

Catalog Number: (89352-592)

Supplier: Genetex

Description: The affinity purified anti IgM mu antibodies only react with IgM by immunodiffusion and Immunoelectrophoretic and ELISA techniques. Goats were immunized with highly purified normal mouse IgM in Freund's adjuvant. The antiserum was solid phase absorbed to make it IgM mu chain specific and the anti mu chain antibodies were isolated by solid phase immunoaffinity chromatography

Sale

Catalog Number: (10340-534)

Supplier: Bioss

Description: Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates.

Sale

Supplier: Bachem Americas

Description: Cholecystokinin (CCK) is a hormone originally isolated from porcine intestinal mucosa and described as a linear 33-amino acid peptide containing a sulfated tyrosine, which is essential for its biological activity. It has been found in mammals in both the digestive tract and the central nervous system. Among its multiple biological functions, this hormone stimulates pancreatic exocrine secretion, gallbladder contraction, and intestine motility and may also act as a neurotransmitter/neuromodulator in the central nervous system. For CCK-4 see H-3110.

Catalog Number: (76048-954)

Supplier: First Aid Only

Description: Personal protection kit for BBP spill cleanup.

Sale

Catalog Number: (RL610-4121)

Supplier: Rockland Immunochemical

Description: Secondary Rabbit Anti-IgG F(ab')2 Reacts with Mouse

Sale

Catalog Number: (10393-652)

Supplier: Bioss

Description: GPR15 is a probable chemokine receptor,its expression has been reported in CD4(+) T lymphocytes, alveolar macrophages, and the basal surface of the small intestinal epithelium. ESTs have been isolated from normal brain and kidney cancer libraries.This gene encodes a G protein-coupled receptor that acts as a chemokine receptor for human immunodeficiency virus type 1 and 2. The encoded protein localizes to the cell membrane. [provided by RefSeq, Nov 2012].

Sale

Catalog Number: (77437-470)

Supplier: Bioss

Description: The Strep-tag system is a method which allows the purification and detection of proteins by affinity chromatography. The Strep-tag is a synthetic peptide consisting of eight amino acids (Trp-Ser-His-Pro-Gln-Phe-Glu-Lys). This peptide sequence exhibits intrinsic affinity towards Strep-Tactin, a specifically engineered streptavidin and can be N- or C- terminally fused to recombinant proteins. By exploiting the highly specific interaction, Strep-tagged proteins can be isolated in one step from crude cell lysates. Because the Strep-tag elutes under gentle, physiological conditions it is especially suited for generation of functional proteins.

Sale

Catalog Number: (10748-880)

Supplier: Prosci

Description: Andes virus (ANDV) is a rodent-borne hantavirus of the family Bunyaviridae, an enveloped, negative-sense RNA viruses with a tripartite genome that can cause hantavirus pulmonary syndrome (HPS). It was isolated from an infected Oligoryzomys longicaudatus rodent in Chile, and is highly similar to the Sin Nombre virus (SNV).

Sale

Supplier: Bachem Americas

Description: Substrates often used for characterizing newly isolated PPIases, subtilisins or other enzymes. Bachem offers Suc-Ala-Ala-Pro-Xaa (Suc-AAPX) substrates containing Ala, Leu, Met, Nle, and Nva (the pancreatic elastase substrates L-1775, L-1390, L-1395, and L-1780), Arg, Asp, Glu, Ile, Lys, Orn, Phe (the PPIase substrates I-1465, L-1400, and M-2305), and Val (the neutrophil elastase substrates I-1490 and L-1770) as Xaa.

Catalog Number: (10403-544)

Supplier: Bioss

Description: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation.

Sale

Catalog Number: (10403-538)

Supplier: Bioss

Description: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation.

Sale

Catalog Number: (102999-386)

Supplier: Anaspec Inc

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
MW: 4670.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale