You Searched For: Ansell+Isolator+Gloves


12,449  results were found

SearchResultCount:"12449"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: BD
Description: Each Gram crystal violet solution contains approximately 0.3% crystal violet aqueous alcohol solution
Supplier: Invitrogen
Description: n-Dodecyl-β-D-Maltoside is especially useful for solubilizing membrane proteins to preserve their activity. Store below -20˚C.
Catalog Number: (76326-030)
Supplier: New England Biolabs (NEB)
Description: This module contains the enzymes and buffers required to lyse isolated cultured and primary cells to extract RNA. The module is optimized for use with the NEBNext Single Cell/Low Input RNA Library Prep Kit for Illumina or NEBNext Single Cell/Low Input cDNA Synthesis and Amplification Module, and can be used to supplement the NEBNext Cell Lysis Buffer and Murine RNase Inhibitor components supplied in these products.


Catalog Number: (10393-646)
Supplier: Bioss
Description: GPR15 is a probable chemokine receptor,its expression has been reported in CD4(+) T lymphocytes, alveolar macrophages, and the basal surface of the small intestinal epithelium. ESTs have been isolated from normal brain and kidney cancer libraries.This gene encodes a G protein-coupled receptor that acts as a chemokine receptor for human immunodeficiency virus type 1 and 2. The encoded protein localizes to the cell membrane. [provided by RefSeq, Nov 2012].


Catalog Number: (89359-530)
Supplier: Genetex
Description: The G protein-coupled receptor GPR81 has been reported primarily in adipose and pituitary. ESTs have been isolated from human bladder cancer and colon cancer libraries. It has not been detected in frontal, temporal and occipital lobes of the cortex, basal forebrain, caudate nucleus, nucleus accumbens, and hippocampus.


Catalog Number: (103003-714)
Supplier: Anaspec Inc
Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4757.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (76049-130)
Supplier: First Aid Only
Description: Protect hands against exposure to germs and bodily fluids with exam quality vinyl gloves.


Supplier: Adipogen
Description: Averantin is a cytotoxic against human solid tumor cell lines.

Catalog Number: (10094-026)
Supplier: Proteintech
Description: RSRC1, also named as SRRP53, is a novel SR-related protein of an apparent molecular mass of 53 kDa (45-53 kDa). It is isolated in a gene trap screen that identifies proteins which localize to the nuclear speckles. RSRC1 plays a rol in pre-mRNA splicing and constitutive.


Catalog Number: (102514-326)
Supplier: Adipogen
Description: Periostin was originally isolated as an osteoblast-specific factor that functions as a cell adhesion molecule for preosteoblasts and is thought to be involved in osteoblast recruitment, attachment and spreading. Additionally, periostin expression has previously been shown to be significantly increased by both transforming growth factor beta1 (TGF-beta1) and bone morphogenetic protein (BMP-2). Abnormal expression of periostin is also linked to angiogenesis and metastasis in epithelial tumors.


Supplier: HiMedia
Description: The HiVeg™ line of products consists of uniquely formulated, 100% vegetable-based media designed to work in conjunction with or replace standard animal-based protein sources.

Catalog Number: (89352-592)
Supplier: Genetex
Description: The affinity purified anti IgM mu antibodies only react with IgM by immunodiffusion and Immunoelectrophoretic and ELISA techniques. Goats were immunized with highly purified normal mouse IgM in Freund's adjuvant. The antiserum was solid phase absorbed to make it IgM mu chain specific and the anti mu chain antibodies were isolated by solid phase immunoaffinity chromatography


Catalog Number: (10340-534)
Supplier: Bioss
Description: Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates.


Catalog Number: (103521-912)
Supplier: IXCELLS BIOTECHNOLOGIES USA MS
Description: Human Hepatic Stellate Cells- Adult (HHSC); Frozen


Catalog Number: (300059-061)
Supplier: Safety & Industrial Supplies
Description: Lined with heat-resistant 100% wool.


Catalog Number: (MSPP-07010)
Supplier: Stemcell Technologies
Description: Anti-Adherence Rinsing Solution is a surfactant solution for pre-treating cultureware to reduce surface tension and prevent cell adhesion. It can be used with plates, flasks, pipettes, strainers and other cultureware.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,889 - 3,904 of 12,449
no targeter for Bottom