You Searched For: Ansell+Isolator+Gloves


12,458  results were found

SearchResultCount:"12458"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (MSPP-18756)
Supplier: Stemcell Technologies
Description: Immunomagnetic positive selection of SCA1+ cells (e.g. hematopoietic stem/progenitor cells) from mouse bone marrow.


Catalog Number: (76200-228)
Supplier: GE Healthcare - Whatman
Description: These mixed cellulose ester membrane filters are designed for asbestos sampling using the membrane filter method for phase contrast microscopy. Asbestos sampling isolates these fibers from circulating air to determine concentrations.


Catalog Number: (PAA8191)
Supplier: Promega Corporation
Description: Components of the Wizard Magnetic DNA Purification System for Food, which is intended for isolating genomic DNA from a variety of food samples including: corn seeds, corn meal, soy beans, soy flour, soy milk, corn oil, soybean oil, canola oil, etc.


Catalog Number: (90003-102)
Supplier: BD
Description: Azide Dextrose Broth is used for cultivating streptococci in water and wastewater.

Catalog Number: (10034-330)
Supplier: Chemglass
Description: The CG-4601 is a self contained vacuum level control unit for maintaining pressures between 1 and 760 Torr. It provides dependable digital control of your vacuum system with an innovative controller technology to make testing easier. It has a gas independent isolated stainless steel sensor and optional stainless steel piping to enable implementation in the most corrosive environments.

Small Business Enterprise


Catalog Number: (102963-634)
Supplier: Cell Biolabs
Description: Cell Biolabs’ Nuclear/Cytosolic Fractionation Kit provides a simple and fast tool to isolate nuclear extract from the cytoplasmic fraction of mammalian cells.  The procedure has been optimized to provide extraction, with high protein recovery and low cross-contamination, in less than 2 hours.  The extracted protein fractions are functional and suitable for downstream assays such as DNA footprinting, RNA splicing, gel shift assays (EMSA), reporter assays, enzyme activity assays, and Western blotting


Catalog Number: (102830-116)
Supplier: Charles River Laboratories Cell Solutions
Description: Human disease state peripheral blood mononuclear cells (PBMC) are collected from human volunteer donors under IRB approved informed consent by whole blood or leukapheresis using the COBE® Spectra Apheresis System MNC collection protocol


Catalog Number: (MSPP-17682)
Supplier: Stemcell Technologies
Description: Immunomagnetic positive selection of any cells labeled with FITC-conjugated antibodies.


Catalog Number: (MSPP-100-0033)
Supplier: Stemcell Technologies
Description: Immunomagnetic positive selection of particle-free mouse cells labeled with APC-conjugated antibodies.


Supplier: Adipogen
Description: Antibiotic

Catalog Number: (89407-062)
Supplier: Hardy Diagnostics
Description: CulGenex™ Heat-and-Pour™ Agarose Gels, which contain ethidium bromide, agarose, and with either TAE or TBE buffers, are recommended for agarose gel electrophoresis in the separation, visualization, quantification, or isolation of particular DNA fragments.

Supplier: Anaspec Inc
Description: Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.
Sequence: VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
MW: 2859.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (76011-036)
Supplier: Prosci
Description: Tetranectin binds to plasminogen and to isolated kringle 4. It may be involved in the packaging of molecules destined for exocytosis.


Supplier: Biotium
Description: CD45 / LCA Monoclonal antibody, Clone: 2B11 + PD7/26, Host: Mouse, Species reactivity: Human, Dog, Isotype: IgG's, Conjugate: CF405S, Immunogen: Isolated neoplastic cells from T cell lymphoma, Synonyms: B220, CD45R, Application: IF, Size: 100uL

Supplier: QUALITY BIOLOGICAL, INC.
Description: YPD is a media variant derived from YPAD. YPAD consists of nutrient base (yeast extract and peptone), adenine supplement and a carbon source. YPD’s formulation is the same but without the additional adenine.

YPD 1/2 Plates are useful for subculturing of untransformed yeast, yeast two-hybrid screening, yeast one-hybrid screening, enrichment and isolation of yeast; ade2 yeast will turn red on YPD.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (10238-064)
Supplier: Bioss
Description: The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.[provided by RefSeq, Nov 2009].


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,505 - 3,520 of 12,458
no targeter for Bottom