16,541  results were found

SearchResultCount:"16541"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103003-714)
Supplier: Anaspec Inc
Description: Corticotropin Releasing Factor, CRF, human, rat, Purity: HPLC >/- 95%, Molecular Weight: 4757.5, Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103009-750)
Supplier: Anaspec Inc
Description: Histone H3 (73-83), Purity: HPLC >/= 95%, Molecular weight: 1336.5, Sequence: [EIAQDFKTDLR] based on amino acids 73 to 83 of histone H3. Lysine 79 of Histone H3 (H3K79) has been identified as a residue for acetylation or methylation, Store: -20 deg C, Size: 1mg


Catalog Number: (103008-006)
Supplier: Anaspec Inc
Description: [Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me2), biotin-labeled, Sequence: ATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, residues 21 to 44 di-methylated at Lys-27, Molecular Weight: 2945.5, Size: 1 mg


Catalog Number: (103003-154)
Supplier: Anaspec Inc
Description: Adrenomedullin (1-52), human, Purity: HPLC >/- 95%, Molecular Weight: 6028.8, Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2, Appearance: Lyophilized white powder, is a 52-amino acid peptide initially isolated from pheochromyctoma, Size: 0.5 mg


Catalog Number: (103010-830)
Supplier: Anaspec Inc
Description: 5(6) - TAMRA, Special Formulation, Synonym: 5-(and-6)-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/565 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 g


Catalog Number: (103010-186)
Supplier: Anaspec Inc
Description: SensoLyte* 520 Aggrecanase-1 Assay Kit *Fluorimetric*, Components: 5-FAM/5-TAMRA 60 ul, 5-FAM 1mM, 10 ul, Assay Buffer 20 Ml, Control Inhibitor 100 u
M, 10 ul, Stop Solution 10 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C


Catalog Number: (103006-670)
Supplier: Anaspec Inc
Description: [Asn23] - beta - amyloid (1 - 42), Iowa Mutation, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA, Molecular weight: 4513.1, Physical State: Powder, Storage: -20 degree C, Size: 0.5 mg


Catalog Number: (103003-516)
Supplier: Anaspec Inc
Description: AMC [7-Amino-4-methylcoumarin], Molecular Formula: C10H9NO2, Molecular Weight: 175.2, Appearance: Solid, Coumarin 120; coumarin 440, Storage: -20 deg C, Size: 1 g


Catalog Number: (102996-468)
Supplier: Anaspec Inc
Description: Thrombin Receptor Activator for Peptide 6 (TRAP-6), Purity: HPLC >/= to 95%, Molecular Weight: 748.9, Sequence: H-Ser-Phe-Leu-Leu-Arg-Asn-OH, This peptide forms the N-terminal sequence left after thrombin cleavage, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103010-390)
Supplier: Anaspec Inc
Description: Human Recombinant MMP-14 (from <i>E. coli</i>)


Catalog Number: (103006-666)
Supplier: Anaspec Inc
Description: Rat Atrial Natriuretic Peptide (4-18)


Catalog Number: (103010-890)
Supplier: Anaspec Inc
Description: 7-Hydroxycoumarin-3-carboxylic acid


Catalog Number: (103008-462)
Supplier: Anaspec Inc
Description: ClearPoint* Angiotensin II, 13C and 15N-labeled, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1053.2, Sequence: I*- I(U13C6,15N), Appearance: Lyophilized powder, octapeptide angiotensin II (Ang II), Storage: -20 degree C, Size: 0.1mg


Catalog Number: (102999-606)
Supplier: Anaspec Inc
Description: Cys - beta - Amyloid (1 - 40), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4433, Apperance: Powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103010-552)
Supplier: Anaspec Inc
Description: Mouse Prorenin, Recombinant, Concentration: 0.5mg/ml, Renin, a protease secreted by the kidney, plays a key role in the renin-angiotensin system, acts by converting the renin substrate, angiotensinogen, to angiotensin I in the blood, Size: 20 ug


Catalog Number: (103003-386)
Supplier: Anaspec Inc
Description: Phytochelatin 2, PC2, Purity: HPLC >/- 95%, Molecular Weight: 540.6, Sequence: H-Y-Glu-Cys-Y-Glu-Cys-Gly-OH, A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 2 units of YGlu-Cys, Storage: -20 deg C, Size: 1 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
49 - 64 of 16,541
no targeter for Bottom