Description: VIP (1-12), human, porcine, rat, Purity: HPLC >/- 95%, Molecular Weight: 1425.5, Sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-OH, this peptide fragment 1-12 with a mass of 1425.5 da, is mostly used as a standard in mass spectrometry, Size: 1 mg

Catalog Number: 103003-696

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (25 - 35). HCl, Human, mouse/rat, Sequence: GSNKGAIIGLM. HCl, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1060.3.36.5, Molecular Formula: C45H81N13O14S1Cl1, Apperance: Powder, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102999-434

Supplier: Anaspec Inc

Sale

Description: Transportan a 27 amino acids (aa) long chimeric peptide containing 12 aa from the amino-terminal part of the neuropeptide galanin, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GWTLNSAGYLLGKINLKALAALAKKIL, MW: 2841.5, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-484

Supplier: Anaspec Inc

Sale

Description: H-D-Phe-Pro-Arg-AFC, Purity: HPLC >/= 95%, Molecular Weight: 629.5, Sequence: fPR-AFC, Appearance: Powder, This is a fluorescent Thrombin substrate, Abs/Em=380/500 nm, Storage: -20 deg C, Size: 10 mg

Catalog Number: 102996-442

Supplier: Anaspec Inc

Sale

Description: Bombesin peptide, Purity: HPLC >/= to 95%, Molecular Weight: 1620.9, Sequence: Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-082

Supplier: Anaspec Inc

Sale

Description: Big Endothelin 1 (1-39), porcine, Purity: HPLC >/= 95%, Molecular Weight: 4384.1, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS, This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-096

Supplier: Anaspec Inc

Sale

Description: QXL* 670 acid, SE, Synonym: QXL* 670 acid, NHS ester, dyes are optimized quenchers for Cy5 and Cy5-like fluorophores such as HiLyte* Fluor 647, Purity: 95%, MW: 801.79, Spectral Properties: Abs/Em = 668/none nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-072

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine - 5 C2 maleimide, alternative to tetramethylrhodamine-5-maleimide, with spectral characteristics, Molecular Weight: 552.58, Molecular Formula: C31H28N4O6, Spectral Properties: Abs/Em = 544/572nm, Solvent System: DMF or DMSO, Size: 5 mg

Catalog Number: 103011-006

Supplier: Anaspec Inc

Sale

Description: [Glu3] - RGES, Control for RGD Peptides, Sequence: RGES, Purity: By HPLC >/= 95%, This peptide is a control for the RGDS Fibronectin Active Fragment and other RGD-related peptides, Molecular Weight: 447.5, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-382

Supplier: Anaspec Inc

Sale

Description: Human MMP - 10, Recombinant, Concentration: 10 ug/mL, Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components, It can be used as a positive control, size: 100 uL

Catalog Number: 103010-388

Supplier: Anaspec Inc

Sale

Description: Angiotensin II, peptide human, Purity: HPLC >/= to 95%, Molecular Weight: 1046.2, Sequence: H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH, Appearance: Lyophilized white powder, exerts a wide range of effects on the cardiovascular system, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-066

Supplier: Anaspec Inc

Sale

Description: Temporin L, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1640, Sequence: FVQWFSKFLGRIL-NH2, hydrophobic peptide amide derived from the frog Rana temporaria, active against Gram-positive /negative bacteria and E. Coli, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-478

Supplier: Anaspec Inc

Sale

Description: Endothelin 1, human, porcine, sequence: CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11), Purity: HPLC greater than or equal to 95%, Molecular Weight: 2492, potent vasoconstrictor peptide derived from endothelial cells, Size: 0.25 mg

Catalog Number: 102999-368

Supplier: Anaspec Inc

Sale

Description: NBD-X, Synonym: 6-(N-(7-Nitrobenz-2-oxa-1,3-diazol-4-yl)amino)hexanoic acid, building block that can be used to prepare peptide conjugates and other bioconjugate, Molecular Weight: 294.27, Spectral Properties: Abs/Em = 467/539 nm, Solvent System: DMSO, Size: 100mg

Catalog Number: 103010-902

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (5-42), Human, Purity: Greater than or equal to 95%( % Peak Area By HPLC), Molecular weight: 4051.6, Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (One-Letter Code), Storage: At -20 Degree C, Size: 0.1mg

Catalog Number: 103002-974

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 MMP-13 Assay Kit *Fluorimetric*, Components: MMP-9 substrate 270 ul, EDANS 1 mM DMSO solution, 10 ul, APMA 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed

Catalog Number: 103010-162

Supplier: Anaspec Inc

Sale