You Searched For: Hytest Ltd


9,686  results were found

SearchResultCount:"9686"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103008-422)
Supplier: Anaspec Inc
Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This amidated peptide sequence is found in C-terminal residues 110 to 119 of the neurohormone Metastin (also referred to as Kisspeptin-10); it increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone).
Sequence:YNWNSFGLRY-NH2
MW:1318.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-778)
Supplier: Anaspec Inc
Description: Pep-1 is one of the synthetic cell-penetrating peptides (CPPs), which has been successfully used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way. It is a CPP with primary amphipathicity (i.e amphipathicity resulting from the amino acid sequence itself, not from the folding structure) that comprises a tryptophan-rich so-called ‘hydrophobic’ domain, a hydrophilic domain derived from an NLS (nuclear localization signal) of SV40 (simian virus 40) large T-antigen, and a spacer between them. A cysteamine group is present at the C-terminus. The presence of cysteamine group in C terminal seems to play a crucial role in the delivery efficiency of cargoes into cells.
Sequence:Ac-KETWWETWWTEWSQPKKKRKV-cysteamine
MW:2950.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103011-314)
Supplier: Anaspec Inc
Description: Unlike FDG that requires a two-step hydrolysis to generate maximum fluorescence, resorufin β-D-galactopyranoside requires only a single-step hydrolysis reaction to attain full fluorescence. This substrate is especially useful for sensitive enzyme measurements in ELISAs. The relatively low pKa (~6.0) of resorufin (the enzymatic hydrolysis product of resorufin galactoside) with Ex/Em=573/585 nm permits continuous measurement of enzymatic activity. Resorufin galactoside has also been used to quantitate β-galactosidase activity in single yeast cells by flow cytometry and to detect immobilized β-galactosidase activity.


Catalog Number: (103007-532)
Supplier: Anaspec Inc
Description: A peptide substrate of O-linked GlcNAc transferase (OGT), a eukaryotic glycosyltransferase that uses UDP-GlcNAc as a glycosyl donor.
Sequence:KKKYPGGSTPVSSANMM
MW:1783.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103011-326)
Supplier: Anaspec Inc
Description: Bind to DNA/RNA (red fluorescence) upon oxidation. Store at -20C desiccated and protected from light


Catalog Number: (103008-718)
Supplier: Anaspec Inc
Description: Gliadin is a gluten component. This peptide is derived from amino acid residues 57-68 of a9-gliadin and represents an immunodominant epitope that has been shown to elicit HLA-DQ2-restricted T-cell responses in celiac patients. This epitope is resistant to pancreatic proteolysis.
Sequence: QLQPFPQPQLPY
MW: 1455.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (103007-546)
Supplier: Anaspec Inc
Description: This is a biotinylated fragment of the human, mouse, rat ß-amyloid (15-25).
Sequence: Biotin-LC-QKLVFFAEDVG
Molecular Weight: 1591.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103006-356)
Supplier: Anaspec Inc
Description: This octapeptide is a COOH-terminal fragment of the C3a anaphylatoxin peptide. On a molar basis, this peptide possesses 1-2% of the biological activities of C3a. It causes contraction of rodent ileum and uterus, release of vasoactive amines from rat mast cells, and increases vascular permeability in guinea pig and human skin. Both purified C3a and synthetic C3a (70-77), which retains partially the activity of anaphylatoxin, are shown to interact directly with human lymphocytes.
Sequence:ASHLGLAR
MW:823.9 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-968)
Supplier: Anaspec Inc
Description: Histone H1-derived peptide, phosphorylated by protein kinase A, is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.
Sequence:GGGPATPKKAKKL
MW:1252.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-520)
Supplier: Anaspec Inc
Description: Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes


Catalog Number: (103010-244)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103008-216)
Supplier: Anaspec Inc
Description: This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 5057.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103010-662)
Supplier: Anaspec Inc
Description: Neprilysin (NEP) is a transmembrane metallopeptidase normally expressed by a variety of tissues


Catalog Number: (103010-690)
Supplier: Anaspec Inc
Description: This is biotinylated Protein A conjugate suitable for asssay development, IHC, IF, immunoprecipitation or western blotting.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development


Catalog Number: (103010-164)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103010-986)
Supplier: Anaspec Inc
Description: Tetramethylrhodamine iodoacetamides (TMRIA) are thiol-selective reactive dyes that are used to label proteins via the cysteine residues. 5-TMRIA, the pure 5-isomer of TMRIA, is increasingly preferred for some particular applications since the mixed isomers of TMRIA may give different results from batch to batch due to the varying ratios and different reactivities of the two isomers. For example, 5-TAMRA is reported to predominantly label SH-1 (Cys-707) of the myosin heavy chain in skinned muscle fibers.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
481 - 496 of 9,686
no targeter for Bottom