You Searched For: b03p


98,498  results were found

SearchResultCount:"98498"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (102229-610)
Supplier: Novus Biologicals


Catalog Number: (103236-958)
Supplier: Novus Biologicals


Catalog Number: (102107-030)
Supplier: Novus Biologicals


Catalog Number: (103308-472)
Supplier: Novus Biologicals
Description: Proteasome 20S beta 6 Monoclonal antibody, Clone: 2A3-5A8, Host: Mouse, Species Reactivity: Human, Isotype: IgG1 Kappa, Immunogen: PSMB6 (AAH00835, 1 aa - 239 aa) full-length recom protein with GST tag, Synonym: LMPY, Application: WB, Size: 0.1 mg


Catalog Number: (103260-252)
Supplier: Novus Biologicals
Description: Connexin 30.1/GJB5, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: Igg, Immunogen: This antibody was developed against Recombinant Protein, Synonyms: Connexin-31.1, CX31.1, CX31.1gap junction beta-5 protein, Applications: WB, IHC, IHC-P, Size: 100ul


Catalog Number: (103285-098)
Supplier: Novus Biologicals
Description: ANKFN1 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rt, Isotype: IgG, Synonym: ankyrin-repeat and fibronectin type III domain containing 1, FLJ38335, Purity: Immunogen affinity purified, Application: IHC, IHC-P, Storage: -20 deg C, Size: 0.1 ml


Catalog Number: (102211-474)
Supplier: Novus Biologicals


Catalog Number: (103062-134)
Supplier: Novus Biologicals
Description: G protein alpha polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Purity: Immunogen affinity purified, Specificity: Protein Array containing target protein plus 383 other non-specific proteins, Application: ICC/IF, IHC, IHC-P, Size: 0.1 ml


Catalog Number: (102223-102)
Supplier: Novus Biologicals


Catalog Number: (103343-002)
Supplier: Novus Biologicals
Description: NXT1, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: NXT1 (AAH00759.1, 1 a.a. - 140 a.a) full-length human Protein, Synonym: Protein p15, Purity: Protein G purified, Application: WB, ELISA, Storage: -20C or -80C, Size: 0.1mg


Catalog Number: (102199-742)
Supplier: Novus Biologicals


Catalog Number: (103344-056)
Supplier: Novus Biologicals
Description: BLU, Polyclonal Antibody, Host: Mouse, Species Reactivity: Human, Isotype: IgG, Immunogen: ZMYND10 (NP-056980.2, 1 a.a. - 440 a.a) full-length human Protein, Synonym: FLU, Purity: Protein A purified, Application: WB, ELISA, Storage: -20C or -80C, Size: 0.05mg


Catalog Number: (102140-080)
Supplier: Novus Biologicals


Catalog Number: (102203-158)
Supplier: Novus Biologicals


Catalog Number: (103276-666)
Supplier: Novus Biologicals
Description: IRF2, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: SLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIE, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL


Catalog Number: (102705-044)
Supplier: Novus Biologicals


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
529 - 544 of 98,498
no targeter for Bottom