Human ACTH (1-39)

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-20611 AS-20610
102998-422EA 403.38 USD
102998-422 103003-906
Human ACTH (1-39)
Proteins and Peptides

This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4541.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR