Human Beta-Amyloid (1-43)

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-25356 AS-25357
102999-852EA 643.08 USD
102999-852 102999-854
Human Beta-Amyloid (1-43)
Proteins and Peptides

Solid Aß (1-43) fibril is the most fibrillogenic of all the Aß peptides known.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Molecular Weight: 4615.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR