Human Scrambled-beta-Amyloid (1-42)

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-25382 AS-25383
102996-722EA 507.15 USD
102996-722 102996-724
Human Scrambled-beta-Amyloid (1-42)
Proteins and Peptides

This is scrambled control peptide used in studies to compare the effects of Beta-Amyloid (1-42).
Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Molecular Weight: 4514.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Citations:
Zhang, QG. et al. (2013). Hypersensitivity of the hippocampal CA3 region to stress-induced neurodegeneration and amyloidogenesis in a rat model of surgical menopause. Brain 136, 1432. doi: 10.1093/brain/awt046.

Nath, S. et al. (2012). Spreading of neurodegenerative pathology via neuron-to-neuron transmission of β-amyloid. J Neurosci 32, 8767.

Davis, R. et al. (2011). Amyloid beta dimers/trimers potently induce cofilin-actin rods that are inhibited by maintaining cofilin-phosphorylation. Mol Neurodegeneration 6, 10.

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR