You Searched For: trans-2-[4-(Trifluoromethyl)phenyl]vinylboronic acid


1  results were found

SearchResultCount:"1"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103008-436)
Supplier: Anaspec Inc
Description: This peptide is a scrambled version of the Gap 27 domain of Connexin.
Sequence:REKIITSFIPT
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Supplier: Thermo Fisher Scientific Chemicals Inc.
Description: 5 kg

Catalog Number: (103007-636)
Supplier: Anaspec Inc
Description: Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Molecular Weight: 4345.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-582)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 22 fragment of the beta-amyloid peptide.
Sequence: DAEFRHDSGYEVHHQKLVFFAE
Molecular Weight: 2661.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (76481-842)
Supplier: AAT BIOQUEST INC
Description: The light-absorbing properties of TAMRA, and spectral overlap with several commonly used fluorophores - including FAM, HEX, TET and JOE, make it useful as a FRET acceptor for the dual labeled FRET probes such as Molecular Beacons.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (103007-120)
Supplier: Anaspec Inc
Description: This is the scrambled beta-Amyloid peptide amino acids 25 to 35. Pairing this peptide with the native b-Amyloid 25 to 35 amino acids peptide has been used to recognize its structure and functions.
Sequence: MAKGINGISGL
Molecular Weight: 1060.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103006-542)
Supplier: Anaspec Inc
Description: Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the dutch mutant, Glu 22 is replaced with Gln, leading to rapid formation of neuroteoxic aggregates with higher proteolysis resistance.
Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Innovative Research Inc
Description: IgD, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 185,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 1.0 mg/ml, Size: 0.1mg

Supplier: Innovative Research Inc
Description: IgG2, Human Plasma, Purity: >95% by SDS-PAGE analysis, Source: Human plasma, Molecular Weight: 150,000, Species: Human, Storage: -70 C, Form: Frozen liquid, Preservative: Sodium Azide, Concentration: 2.5 mg/ml, Size: 5mg

Catalog Number: (103010-902)
Supplier: Anaspec Inc
Description: NBD-X, Synonym: 6-(N-(7-Nitrobenz-2-oxa-1,3-diazol-4-yl)amino)hexanoic acid, building block that can be used to prepare peptide conjugates and other bioconjugate, Molecular Weight: 294.27, Spectral Properties: Abs/Em = 467/539 nm, Solvent System: DMSO, Size: 100mg


Catalog Number: (103006-916)
Supplier: Anaspec Inc
Description: This peptide spans the C-terminus of histone H3, amino acids 116 to 136.
Sequence:KRVTIMPKDIQLARRIRGERA
MW:2508 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.

Catalog Number: (76484-786)
Supplier: AAT BIOQUEST INC
Description: Adenosine triphosphate (ATP) plays a fundamental role in cellular energetics, metabolic regulation and cellular signaling.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:5-FAM-KRREILSRRPSYR
MW:2075.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc
Description: This is a membrane-permeable peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminus of phosducin-like protein.
Sequence:AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
MW:4601.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-896)
Supplier: Anaspec Inc
Description: Chromogenic substrate for Kallikrein 3, commonly known as prostate specific antigen (PSA)
Sequence:Suc-RPY-pNA
MW:654.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-143 - -128 of 1
no targeter for Bottom