960  results were found

SearchResultCount:"960"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: Trimethylamine, pure, 7.3M (50 wt.%) aqueous solution, Size: 500ml

Supplier: TLC PHARMACEUTICAL STANDARD LTD
Description: Pharmaceutical Standards, Fingolimod Impurity 50

Supplier: Thermo Scientific Chemicals
Description: 1-Propylphosphonic acid cyclic anhydride, 50+% w/w soln. in acetonitrile
Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: Acetic acid 50% in water

Supplier: DuPont
Description: DuPont™ Tychem® 4000 delivers effective protection against a range of chemical environments.

Supplier: Aqua Solutions
Description: Ammonia solution 50% (v/v) in aqueous solution

SDS

Supplier: VWR International
Description: High polarity phase, ideal for detailed FAMEs and Dioxins isomers separation.

Catalog Number: (RCR9657000500A)
Supplier: Ricca Chemical
Description: Zinc sulfate 0.0200 M (M/50)


Catalog Number: (76299-642)
Supplier: New England Biolabs (NEB)
Description: The Monarch® RNA Cleanup Columns (50 µg) are a component of the Monarch® RNA Cleanup Kit (50 µg) and can be used to purify up to 50 µg of RNA from enzymatic reactions. 


Supplier: Eppendorf
Description: Eppendorf Tubes® with snap caps are an ideal choice when working with medium-sized sample volumes (0.5 to 5.0 ml). Designed for user-friendly handling, broad temperature ranges, centrifugation safety (up to 25,000×g), and sample recovery.

Environmentally Preferable Product available on GSA Advantage®

Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: D-Gluconic acid 50% (w/w) in water

Catalog Number: (10016-956)
Supplier: DuPont
Description: Tyvek® 400 garments are composed of flash spun high density polyethylene which creates a unique, nonwoven material available only from DuPont.


Catalog Number: (103255-116)
Supplier: Beckman Coulter
Description: The JS-5.0 Swinging-bucket rotor assembly with labware kit.

Product available on GSA Advantage®


Catalog Number: (TS433111000)
Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: tert-Butylchlorodimethylsilane 50% (w/w) in toluene, AcroSeal®

New Product


Supplier: Epredia
Description: Yield high-quality sections down to–50°C without chatter using Epredia™ Neg-50™ Frozen Section Medium, a water-soluble frozen section medium.

SDS

Catalog Number: (103009-478)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (1-50) biotinylated through a C-terminal GGK linker. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE-GGK(Biotin)
MW:5809.8 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 960
no targeter for Bottom