You Searched For: 3-Phenoxybenzyl alcohol


19  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"19"
Catalog Number: 470014-262
Supplier: VWR International


Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.1 mg
Catalog Number: 103003-546
Supplier: Anaspec Inc


Description: Biotin-X NTA [[Biotin-X nitrilotriacetic acid, tripotassium salt]], Molecular Weight: 716, Appearance: solid, Solvent System: water, Excellent reagent for detecting polyhistidine-containing biomolecules, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103003-304
Supplier: Anaspec Inc


Description: Beta-Amyloid (1-15), Human, Purity: HPLC >/= 95%, Sequence (1-Letter Code): DAEFRHDSGYEVHHQ, Sequence (3-Letter Code): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH, Molecular weight: 1826.9, Physical State: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-990
Supplier: Anaspec Inc


Description: HiLyte* Fluor 488 C2 maleimide, thiol-reactive fluorescent labeling dye, that generates the protein conjugates, Molecular Weight: 567.55, Spectral Properties: Abs/Em = 502/527 nm, Solvent System DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103010-882
Supplier: Anaspec Inc


Description: Beta - Amyloid (22 - 42), Human, mouse/rat, Sequence: EDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42, Molecular Weight: 1999.4, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-122
Supplier: Anaspec Inc


Catalog Number: 470014-292
Supplier: VWR International


Description: Beta - Amyloid (20 - 42), Human, mouse/rat, Sequence: FAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein, Molecular Weight: 2217.6, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-132
Supplier: Anaspec Inc


Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 4742.4, Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: TAMRA, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Abs/Em=551/567 nm, Size: 0.1 mg
Catalog Number: 103003-174
Supplier: Anaspec Inc


Description: 2,6-Diisopropylphenylimido neophylidene racemic-BIPHEN molybdenum (VI), purity: Min 97%, CAS number: 300344-02-9, molecular Formula: C46H61MoNO2, Color: red, Form: crystalline, Size: 0.5g
Catalog Number: 100203-140
Supplier: Strem Chemicals Inc


Description: 2,6-Diisopropylphenylimido neophylidene racemic-BIPHEN molybdenum (VI), purity: Min 97%, CAS number: 300344-02-9, molecular Formula: C46H61MoNO2, Color: red, Form: crystalline, Size: 0.1g
Catalog Number: 100203-138
Supplier: Strem Chemicals Inc


Description: 25 mL
Catalog Number: 101170-290
Supplier: Thermo Fisher Scientific Chemicals Inc.

Description: 100 mL
Catalog Number: 101175-822
Supplier: Thermo Fisher Scientific Chemicals Inc.

Description: 500 mL
Catalog Number: 101174-830
Supplier: Thermo Fisher Scientific Chemicals Inc.

Description: 1 L
Catalog Number: 101175-820
Supplier: Thermo Fisher Scientific Chemicals Inc.

Description: 3'-DABCYL CPG 1000 /Aring;, DABCYL is one of the most commonly used dark quenchers for labeling oligos and peptides. The resulted conjugates are widely used as diagnostic probes such as Molecular Beacons and protease substrates, Size: 1g
Catalog Number: 76481-818
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


1 - 16 of 19