Print…

You Searched For: 5-Bromo-2-(trifluoromethoxy)benzyl alcohol


12  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"12"

Rate These Search Results

Image Unavailable-103013-894

Human UCH-L1 Protein 50ug

Description: UCH-L1 Protein, Host: E.coli, Species Reactivity: Human, Purity: >92% (SDS-PAGE), Molecular Characterization: rh UCHL1 is fused with a polyhistidine tag at the N-terminus, with calculated MW of of 25.7 KDa, Synonyms: UCHL1,PGP9.5, Storage: 4 degree C, Size: 50ug
Catalog Number: 103013-894
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-932

Human ErbB4/Her4 Protein 100ug

Description: ErbB4/Her4 Protein, Host: HEK293 Cells, Species reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: His Tag is fused with a polyhistidine tag at the C-terminus, MW of 70.6 kDa, Synonym: HER4, ErbB4, MGC138404, p180erbB4, Size: 100ug
Catalog Number: 103012-932
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-918

ActiveMax* Recombinant Human VEGF121

Description: ActiveMax* Recombinant VEGF121 (HPLC-verified), Host: HEK293 cells, Species Reactivity: Human, Purity: >95%(SDS-PAGE), Molecular Characterization: Tag Free, with calculated MW of of 14 KDa, Synonyms: RP1-261G23.1,MGC70609,MVCD1,VEGFA, Size: 1mg
Catalog Number: 103013-918
Supplier: ACROBIOSYSTEMS
Image Unavailable-103006-346

GRGDS amide (GRGDS - NH2) 5 mg

Description: GRGDS, amide (GRGDS - NH2), Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code: H - Gly - Arg - Gly - Asp - Ser - NH2, Molecular Weight: 489.5, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg
Catalog Number: 103006-346
Supplier: Anaspec Inc
Image Unavailable-103012-296

Human CADM1/IGSF4A Protein 100ug

Description: Human CADM1/IGSF4A Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 38.5 kDa, Synonym: CADM1,BL2,IGSF4,IGSF-4,IGSF4A, size: 100ug
Catalog Number: 103012-296
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-656

Recom LRP-5 human >90% 96.6 kDa 100UG

Description: LRP-5 Protein, Mouse IgG2a Fc Tag, Recombinant, Source: HEK293, Species: human,Purity: >90% as determined by SDS-PAGE, Molecular weight: 96.6 kDa, Synonyms: LRP5, LRP-5, LRP-7, LRP7, LR3, Size: 100UG
Catalog Number: 103790-656
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-658

Recom LRP-5 human >90% sds 96.6 kDa 1mg

Description: LRP-5 Protein, Mouse IgG2a Fc Tag, Recombinant, Source: HEK293, Species: human,Purity: >90% as determined by SDS-PAGE, Molecular weight: 96.6 kDa, Synonyms: LRP5, LRP-5, LRP-7, LRP7, LR3, Size: 1mg
Catalog Number: 103790-658
Supplier: ACROBIOSYSTEMS
Image Unavailable-103790-744

Recom PLGF PGF Protein Rhesus >90% 1mg

Description: PLGF PGF Protein, Recombinant, Source: HEK293, Species: Rhesus macaque,Purity: >90% as determined by SDS-PAGE, Molecular weight: 19.3 kDa, Synonyms: PGF, PLGF, PlGF2, PlGF, PGFL, SHGC-10760, Size: 1mg
Catalog Number: 103790-744
Supplier: ACROBIOSYSTEMS
Image Unavailable-103007-426

WP9QY, TNF-alpha Antagonist 1 mg

Description: WP9QY, TNF-alpha Antagonist, Sequence: YCWSQYLCY (Disulfide bridge: 2-8), Purity: By HPLC >/= 95%, cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I, Molecular Weight: 1226.4, Size: 1 mg
Catalog Number: 103007-426
Supplier: Anaspec Inc
Image Unavailable-102999-858

Beta - Amyloid (10 - 20) 1 mg

Description: Beta - Amyloid (10 - 20), Human, Sequence: YEVHHQKLVFF, Purity: HPLC greater than or equal to 95%, A number of AB fragments including AB (10-20) enhances aggregation of AB (1-40), Molecular Weight: 1446.7, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-858
Supplier: Anaspec Inc
Image Unavailable-103006-504

Beta-Amyloid (1-40)-Lys(Biotin)-NH2 Human 0.1 mg

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Molecular weight: 4683.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg
Catalog Number: 103006-504
Supplier: Anaspec Inc
Image Unavailable-10779-026

Recombinant Human Prokineticin-2

Description: Recombinant Human Prokineticin-2, 8.8 kDa protein consisting of 81 amino acid residues, including 10 cysteine residues, cysteine-rich secreted protein, Source: E.coli, Cross Reactivity: Mouse, Rat, Human, >98%, Synonyms: PROK2, PK2, Protein Bv8 homolog, 5UG
Catalog Number: 10779-026
Supplier: PeproTech, Inc.
Image Unavailable-10779-030

Recombinant Human Prokineticin-2

Description: Recombinant Human Prokineticin-2, 8.8 kDa protein consisting of 81 amino acid residues, including 10 cysteine residues, cysteine-rich secreted protein, Source: E.coli, Cross Reactivity: Mouse, Rat, Human, >98%, Synonyms: PROK2, PK2, Protein Bv8 homolog, 50UG
Catalog Number: 10779-030
Supplier: PeproTech, Inc.
Image Unavailable-10779-028

Recombinant Human Prokineticin-2

Description: Recombinant Human Prokineticin-2, 8.8 kDa protein consisting of 81 amino acid residues, including 10 cysteine residues, cysteine-rich secreted protein, Source: E.coli, Cross Reactivity: Mouse, Rat, Human, >98%, Synonyms: PROK2, PK2, Protein Bv8 homolog, 20UG
Catalog Number: 10779-028
Supplier: PeproTech, Inc.
Image Unavailable-76077-340

Human IL-12 p70 Recombinant Protein 500UG

Description: Human IL-12 p70 Recombinant Protein, Purity: >98%, Source: HEK293 cells, Biological Activity: Determined by its ability to increase IFN-Y production by anti-TCR mAb-stimulated PBMCs, Synonyms: Interleukin-12, NKS
Catalog Number: 76077-340
Supplier: PeproTech, Inc.
Image Unavailable-76077-338

Human IL-12 p70 Recombinant Protein 250UG

Description: Human IL-12 p70 Recombinant Protein, Purity: >98%, Source: HEK293 cells, Biological Activity: Determined by its ability to increase IFN-Y production by anti-TCR mAb-stimulated PBMCs, Synonyms: Interleukin-12, NKS
Catalog Number: 76077-338
Supplier: PeproTech, Inc.
1 - 12 of 12